PREFIX nxdetector: PREFIX rdf: PREFIX rdfs: PREFIX xsd: a rdfs:Class ; rdfs:label "NXsqom/ENTRY/instrument/name" ; rdfs:comment "Name of the instrument from which this data was reduced. " ; rdfs:seeAlso ; rdfs:subClassOf , . a rdf:Property ; rdfs:comment "Representation of having a Unit assigned." ; rdfs:domain ; rdfs:range . a rdf:Property ; rdfs:comment "A representation of a \"has a\" relationship." ; rdfs:domain ; rdfs:range . a rdf:Property ; rdfs:comment "Representation fo having a Value assigned." ; rdfs:domain ; rdfs:range . a rdf:Property ; rdfs:domain ; rdfs:range . a rdfs:Class ; rdfs:label "NXtofnpd/entry/user" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NX_SCATTERING_LENGTH_DENSITY" ; rdfs:comment """ \t\t\t\tunits of scattering length density \t\t\t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsas/ENTRY/INSTRUMENT/DETECTOR/data" ; rdfs:comment """ This is area detector data, number of x-pixel versus number of y-pixels. Since the beam center is to be determined as a step of data reduction, it is not necessary to document or assume the position of the beam center in acquired data. It is necessary to define which are the x and y directions, to coordinate with the pixel size and compute Q. """ ; rdfs:seeAlso ; rdfs:subClassOf nxdetector:data , . nxdetector:y_pixel_size a rdfs:Class ; rdfs:label "NXdetector/y_pixel_size" ; rdfs:comment "Size of each detector pixel. If it is scalar all pixels are the same size" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXfresnel_zone_plate/mask_thickness" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXfluo/entry/title" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcollimator/frequency" ; rdfs:comment "Frequency of oscillating collimator" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXguide/substrate_roughness" ; rdfs:comment "TODO: documentation needed" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXlauetof/entry/sample/name" ; rdfs:comment "Descriptive name of sample" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXdetector/efficiency/efficiency" ; rdfs:comment "efficiency of the detector" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/PROCESS/COLLECTION" ; rdfs:comment """ Describes anything about *SASprocess* that is not already described. Any content not defined in the canSAS standard can be placed at this point. Note: The name of this group is flexible, it could take any name, as long as it is unique within the **NXprocess** group. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXreflections/observed_phi/description" ; rdfs:comment "Describes the dataset " ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmonochromator/energy" ; rdfs:comment "energy selected" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtofnpd/entry/MONITOR/distance" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsample/distance" ; rdfs:comment """ \t\t\tTranslation of the sample along the Z-direction of the laboratory coordinate system. \t\t\tNote, it is recommended to use NXtransformations instead. \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdetector_group/default" ; rdfs:comment """ .. index:: plotting Declares which child group contains a path leading to a :ref:`NXdata` group. It is recommended (as of NIAC2014) to use this attribute to help define the path to the default dataset to be plotted. See https://www.nexusformat.org/2014_How_to_find_default_data.html for a summary of the discussion. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmonopd/entry/SAMPLE" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/observed_phi_var" ; rdfs:comment """ The variance on the estimate of the phi angle at which the central impact of the reflection was recorded """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdetector/data_file" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxnb/entry/instrument/detector/tilt_angle" ; rdfs:comment """ The angle by which the detector has been tilted out of the scattering plane. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcrystal/transmission" ; rdfs:comment "crystal transmission versus wavelength" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXentry/IDF_Version" ; rdfs:comment "ISIS Muon IDF_Version" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXarpes/ENTRY/SAMPLE/temperature" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmirror/coating_material" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsample/unit_cell_class" ; rdfs:comment """ In case it is all we know and we want to record/document it """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/predicted_y" ; rdfs:comment """ The y position at which the bragg peak of the reflection is predicted """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/entering/description" ; rdfs:comment "Describes the dataset " ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxkappa/entry/sample/alpha" ; rdfs:comment "This holds the inclination angle of the kappa arm. " ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXenvironment/short_name" ; rdfs:comment "Alternative short name, perhaps for dashboard display like a present Seblock name" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXflipper/guide_turns" ; rdfs:comment "Linear density of turns (such as number of turns/cm) in guide field coils" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXstxm/ENTRY/title" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcrystal/segment_height" ; rdfs:comment "Vertical height of individual segment" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsample/external_DAC" ; rdfs:comment "value sent to user's sample setup" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtomophase/entry/title" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsastof/ENTRY/control/time_of_flight" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtomophase/entry/data" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/BEAM/incident_polarization_stokes" ; rdfs:comment """ Polarization vector on entering beamline component using Stokes notation. See incident_polarization_stokes in :ref:`NXbeam` """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXxasproc/ENTRY/XAS_data_reduction/parameters/raw_file" ; rdfs:comment "Original raw data file this data was derived from" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtofsingle" ; rdfs:comment "This is a application definition for raw data from a generic TOF instrument" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxkappa/entry/instrument/detector" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmoderator/OFF_GEOMETRY" ; rdfs:comment """ This group describes the shape of the moderator """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXstxm/ENTRY" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXmirror/interior_atmosphere" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsensor" ; rdfs:comment """ \t\tA sensor used to monitor an external condition \t\t \t\tThe condition itself is described in :ref:`NXenvironment`. \t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXfluo/entry/MONITOR/preset" ; rdfs:comment "preset value for time or monitor" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXevent_data/default" ; rdfs:comment """ .. index:: plotting Declares which child group contains a path leading to a :ref:`NXdata` group. It is recommended (as of NIAC2014) to use this attribute to help define the path to the default dataset to be plotted. See https://www.nexusformat.org/2014_How_to_find_default_data.html for a summary of the discussion. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXprocess/default" ; rdfs:comment """ .. index:: plotting Declares which child group contains a path leading to a :ref:`NXdata` group. It is recommended (as of NIAC2014) to use this attribute to help define the path to the default dataset to be plotted. See https://www.nexusformat.org/2014_How_to_find_default_data.html for a summary of the discussion. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcrystal/is_cylindrical" ; rdfs:comment "Is this crystal bent cylindrically?" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsas/ENTRY/SAMPLE/name" ; rdfs:comment "Descriptive name of sample." ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXarchive/entry/user/name" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NX_PER_AREA" ; rdfs:comment """ \t\t\t\tunits of 1/length^2 \t\t\t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsample/rotation_angle" ; rdfs:comment """ \t\t\tOptional rotation angle for the case when the powder diagram has \t\t\tbeen obtained through an omega-2theta scan like from a traditional \t\t\tsingle detector powder diffractometer. \t\t\tNote, it is recommended to use NXtransformations instead. \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/INSTRUMENT/APERTURE/x_gap" ; rdfs:comment "opening along the :math:`x` axis" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsample_component/unit_cell_alphabetagamma" ; rdfs:comment "Crystallography unit cell parameters alpha, beta, and gamma" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxkappa" ; rdfs:comment """ raw data from a kappa geometry (CAD4) single crystal diffractometer, extends :ref:`NXxbase` This is the application definition for raw data from a kappa geometry (CAD4) single crystal diffractometer. It extends :ref:`NXxbase`, so the full definition is the content of :ref:`NXxbase` plus the data defined here. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXvelocity_selector" ; rdfs:comment "A neutron velocity selector" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsensor/short_name" ; rdfs:comment "Short name of sensor used e.g. on monitor display program" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXfermi_chopper/number" ; rdfs:comment "number of slits" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsample/mass" ; rdfs:comment "Mass of sample" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreftof/entry/instrument/chopper" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXfermi_chopper/slit" ; rdfs:comment "width of an individual slit" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXbending_magnet/depends_on" ; rdfs:comment """ NeXus positions components by applying a set of translations and rotations to apply to the component starting from 0, 0, 0. The order of these operations is critical and forms what NeXus calls a dependency chain. The depends_on field defines the path to the top most operation of the dependency chain or the string \".\" if located in the origin. Usually these operations are stored in a NXtransformations group. But NeXus allows them to be stored anywhere. .. todo:: Add a definition for the reference point of a bending magnet. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXlauetof/entry/instrument/detector/y_pixel_size" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmoderator/temperature" ; rdfs:comment "average/nominal moderator temperature" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsample/situation" ; rdfs:comment """ \t\t\tThe atmosphere will be one of the components, which is where \t\t\tits details will be stored; the relevant components will be \t\t\tindicated by the entry in the sample_component member. \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/PROCESS/NOTE" ; rdfs:comment """ \t Any additional notes or subprocessing steps will be documented here. \t \t An **NXnote** group can be added to any NeXus group at or below the \t **NXentry** group. It is shown here as a suggestion of a good place \t to *consider* its use. \t""" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXfilter/transmission" ; rdfs:comment "Wavelength transmission profile of filter" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXfresnel_zone_plate/outermost_zone_width" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXentry/definition_local/version" ; rdfs:comment "NXDL version number" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtomo/entry/sample/z_translation" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdetector/stop_time/start" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXbeam/depends_on" ; rdfs:comment """ The NeXus coordinate system defines the Z axis to be along the nominal beam direction. This is the same as the McStas coordinate system (see :ref:`Design-CoordinateSystem`). However, the additional transformations needed to represent an altered beam direction can be provided using this depends_on field that contains the path to a NXtransformations group. This could represent redirection of the beam, or a refined beam direction. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxraylens/lens_geometry" ; rdfs:comment "Geometry of the lens" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXfilter/depends_on" ; rdfs:comment """ NeXus positions components by applying a set of translations and rotations to apply to the component starting from 0, 0, 0. The order of these operations is critical and forms what NeXus calls a dependency chain. The depends_on field defines the path to the top most operation of the dependency chain or the string \".\" if located in the origin. Usually these operations are stored in a NXtransformations group. But NeXus allows them to be stored anywhere. .. todo:: Add a definition for the reference point of a filter. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcapillary/working_distance" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXspe/ENTRY/data/azimuthal" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXfresnel_zone_plate/TRANSFORMATIONS" ; rdfs:comment """ \"Engineering\" position of the fresnel zone plate This is the group recommended for holding the chain of translation and rotation operations necessary to position the component within the instrument. The dependency chain may however traverse similar groups in other component groups. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXtomophase/entry/instrument/SOURCE" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreftof/entry/instrument/chopper/distance" ; rdfs:comment "Distance between chopper and sample" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/DATA" ; rdfs:comment """ A *SASData* group contains a single reduced small-angle scattering data set that can be represented as :math:`I(\\vec{Q})` or :math:`I(|\\vec{Q}|)`. *Q* can be either a vector (:math:`\\vec{Q}`) or a vector magnitude (:math:`|\\vec{Q}|`) The name of each *SASdata* group must be unique within a SASentry group. Suggest using names such as ``sasdata01``. NOTE: For the first *SASdata* group, be sure to write the chosen name into the `SASentry/@default` attribute, as in:: SASentry/@default=\"sasdata01\" A *SASdata* group has several attributes: * I_axes * Q_indices * Mask_indices To indicate the dependency relationships of other varied parameters, use attributes similar to ``@Mask_indices`` (such as ``@Temperature_indices`` or ``@Pressure_indices``). """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXdetector/time_of_flight/long_name" ; rdfs:comment "Total time of flight" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXarchive/entry/duration" ; rdfs:comment "TODO: needs documentation" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXfresnel_zone_plate/central_stop_material" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtas/entry/SAMPLE/orientation_matrix" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXarchive/entry/program" ; rdfs:comment "The program and version used for generating this file" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmonitor/data" ; rdfs:comment """ \t Monitor data \t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NX_NUMBER" ; rdfs:comment "any valid NeXus number representation" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "ISO8601" ; rdfs:comment """ \t\t\tISO8601 date/time stamp. \t\t\tIt is recommended to add an explicit time zone, \t\t\totherwise the local time zone *is assumed* per ISO8601. \t\t\tThe norm is that if there is no time zone, it is assumed \t\t\tlocal time, however, when a file moves from one country to \t\t\tanother it is undefined. If the local time zone is written, \t\t\tthe ambiguity is gone. \t\t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxrot/entry/instrument/detector/polar_angle" ; rdfs:comment "The polar_angle (two theta) where the detector is placed." ; rdfs:seeAlso ; rdfs:subClassOf nxdetector:polar_angle , . a rdfs:Class ; rdfs:label "NXtas/entry/INSTRUMENT/DETECTOR/data" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/DETECTOR/DETECTOR_MODULE/module_offset/transformation_type" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXdetector_module/slow_pixel_direction" ; rdfs:comment """ Values along the direction of :ref:`slowest varying` :index:`pixel direction`. Each value in this array is the size of a pixel in the units specified. Alternatively, if only one value is given, all pixels in this direction have the same value. The direction itself is given through the vector attribute. \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NX_POWER" ; rdfs:comment """ \t\t\t\tunits of power \t\t\t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsensor/geometry" ; rdfs:comment """ \t\t\tDefines the axes for logged vector quantities if they are not the global instrument axes. \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY" ; rdfs:comment """ .. index:: NXcanSAS (applications); SASentry Place the canSAS ``SASentry`` group as a child of a NeXus ``NXentry`` group (when data from multiple techniques are being stored) or as a replacement for the ``NXentry`` group. Note: It is required for all numerical objects to provide a *units* attribute that describes the engineering units. Use the Unidata UDunits [#]_ specification as this is compatible with various community standards. .. [#] The UDunits specification also includes instructions for derived units. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXlauetof/entry/control/preset" ; rdfs:comment "preset value for time or monitor" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/INSTRUMENT/APERTURE/canSAS_class" ; rdfs:comment "Official canSAS group: :index:`NXcanSAS (applications); SASaperture`" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXinstrument" ; rdfs:comment """ \t\tCollection of the components of the instrument or beamline. \t\t \t\tTemplate of instrument descriptions comprising various beamline components. \t\tEach component will also be a NeXus group defined by its distance from the \t\tsample. Negative distances represent beamline components that are before the \t\tsample while positive distances represent components that are after the sample. \t\tThis device allows the unique identification of beamline components in a way \t\tthat is valid for both reactor and pulsed instrumentation. \t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXfilter/thickness" ; rdfs:comment "Thickness of the filter" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXlauetof/entry/control/mode" ; rdfs:comment """ Count to a preset value based on either clock time (timer) or received monitor counts (monitor). """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXinstrument/BEAM_STOP" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmonopd/entry/SAMPLE/name" ; rdfs:comment "Descriptive name of sample" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXreftof/entry/instrument/detector/distance" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXbending_magnet/bending_radius" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/lp" ; rdfs:comment """ The LP correction factor to be applied to the reflection intensities """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NX_COMPLEX" ; rdfs:comment """ \t\t\t\tCompound type representation of complex numbers (either \t\t\t\tcartesian or polar form) in NeXus. \t\t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtofsingle/entry/SAMPLE/name" ; rdfs:comment "Descriptive name of sample" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXarpes/ENTRY/SAMPLE/name" ; rdfs:comment "Descriptive name of sample" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXtofnpd/entry/title" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsample/temperature_log" ; rdfs:comment "temperature_log.value is a link to e.g. temperature_env.sensor1.value_log.value" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXnote/author" ; rdfs:comment "Author or creator of note" ; rdfs:seeAlso ; rdfs:subClassOf . nxdetector:threshold_energy a rdfs:Class ; rdfs:label "NXdetector/threshold_energy" ; rdfs:comment """ Single photon counter detectors can be adjusted for a certain energy range in which they work optimally. This is the energy setting for this. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/flags/description" ; rdfs:comment "Describes the dataset " ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/TRANSMISSION_SPECTRUM/Tdev" ; rdfs:comment """ .. index:: NXcanSAS (applications); Tdev Estimated uncertainty (usually standard deviation) in :math:`T`. Must have the same units as :math:`T`. This is the field is named in the *uncertainties* attribute of *T*, as in:: T/@uncertainties=\"Tdev\" This array is of the same shape as ``lambda`` and ``T``. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXfresnel_zone_plate/zone_height" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXarpes/ENTRY/INSTRUMENT/analyser/region_size" ; rdfs:comment "size of rectangular region selected for readout" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/background_mean" ; rdfs:comment """ The mean background under the reflection peak """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtransformations/AXISNAME/depends_on" ; rdfs:comment """ \t\t\t\tPoints to the path to a field defining the axis on which this \t\t\t\tdepends or the string \".\". \t\t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXrefscan/entry/sample/rotation_angle" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxraylens/focus_type" ; rdfs:comment """ The type of focus of the lens """ ; rdfs:seeAlso ; rdfs:subClassOf . nxdetector:flatfield_applied a rdfs:Class ; rdfs:label "NXdetector/flatfield_applied" ; rdfs:comment """ True when the flat field correction has been applied in the electronics, false otherwise. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsqom/ENTRY/DATA/qy" ; rdfs:comment "Positions for the the second dimension of Q" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXbeam_stop/x" ; rdfs:comment """ x position of the beamstop in relation to the detector. Note, it is recommended to use NXtransformations instead. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXentry/revision" ; rdfs:comment """ \t\t\tRevision id of the file due to re-calibration, reprocessing, new analysis, new \t\t\tinstrument definition format, ... \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXarchive/entry/entry_identifier" ; rdfs:comment "unique identifier for this measurement as provided by the facility" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXstxm/ENTRY/INSTRUMENT" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXreflections/observed_px_y_var" ; rdfs:comment """ The variance on the estimate of the pixel y position at which the central impact of the reflection was recorded """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXstxm/ENTRY/INSTRUMENT/sample_y" ; rdfs:comment " Measurements of the sample position from the y-axis interferometer." ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXinstrument/DETECTOR" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreftof/entry/sample" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmonitor/default" ; rdfs:comment """ .. index:: plotting Declares which child group contains a path leading to a :ref:`NXdata` group. It is recommended (as of NIAC2014) to use this attribute to help define the path to the default dataset to be plotted. See https://www.nexusformat.org/2014_How_to_find_default_data.html for a summary of the discussion. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXfresnel_zone_plate/fabrication" ; rdfs:comment "how the zone plate was manufactured" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/experiments" ; rdfs:comment "The experiments from which the reflection data derives " ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcrystal/segment_gap" ; rdfs:comment "Typical gap between adjacent segments" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsample_component/point_group" ; rdfs:comment "Crystallographic point group, deprecated if space_group present" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreftof/entry/control/integral" ; rdfs:comment "Total integral monitor counts" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXrefscan" ; rdfs:comment """ This is an application definition for a monochromatic scanning reflectometer. It does not have the information to calculate the resolution since it does not have any apertures. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtomoproc/entry/data/y" ; rdfs:comment """ This is an array holding the values to use for the y-axis of data. The units must be appropriate for the measurement. """ ; rdfs:seeAlso ; rdfs:subClassOf , . nxdetector:calibration_date a rdfs:Class ; rdfs:label "NXdetector/calibration_date" ; rdfs:comment """ date of last calibration (geometry and/or efficiency) measurements """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcapillary/maximum_incident_angle" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtas/entry/INSTRUMENT/analyser/polar_angle" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsource/depends_on" ; rdfs:comment """ NeXus positions components by applying a set of translations and rotations to apply to the component starting from 0, 0, 0. The order of these operations is critical and forms what NeXus calls a dependency chain. The depends_on field defines the path to the top most operation of the dependency chain or the string \".\" if located in the origin. Usually these operations are stored in a NXtransformations group. But NeXus allows them to be stored anywhere. The reference point of the source plane is its center in the x and y axis. The source is considered infinitely thin in the z axis. .. image:: source/source.png :width: 40% """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtas/entry" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXsastof/ENTRY/instrument/collimator/geometry/shape/shape" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXmoderator/coupling_material" ; rdfs:comment "The material used for coupling. Usually Cd." ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXbending_magnet/GEOMETRY" ; rdfs:comment "\"Engineering\" position of bending magnet" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/TRANSMISSION_SPECTRUM/name" ; rdfs:comment """ Identify what type of spectrum is being described. It is expected that this value will take either of these two values: ====== ============================================== value meaning ====== ============================================== sample measurement with the sample and container can measurement with just the container ====== ============================================== """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/predicted_frame" ; rdfs:comment """ The frame on which the bragg peak of the reflection is predicted """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxasproc/ENTRY/DATA" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmoderator" ; rdfs:comment "A neutron moderator" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcite/endnote" ; rdfs:comment "Bibliographic reference data in EndNote format." ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NX_CHAR_OR_NUMBER" ; rdfs:comment "Any valid character string or NeXus number representation" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsample/default" ; rdfs:comment """ .. index:: plotting Declares which child group contains a path leading to a :ref:`NXdata` group. It is recommended (as of NIAC2014) to use this attribute to help define the path to the default dataset to be plotted. See https://www.nexusformat.org/2014_How_to_find_default_data.html for a summary of the discussion. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXnote" ; rdfs:comment """ \t\tAny additional freeform information not covered by the other base classes. \t\t \t\tThis class can be used to store additional information in a \t\tNeXus file e.g. pictures, movies, audio, additional text logs \t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdata/signal" ; rdfs:comment """ \t\t\t.. index:: find the default plottable data \t\t\t.. index:: plotting \t\t\t.. index:: signal attribute value \t\t\t \t\t\tThe value is the :ref:`name ` of the signal that contains \t\t\tthe default plottable data. This field or link *must* exist and be a direct child \t\t\tof this NXdata group. \t\t\t \t\t\tIt is recommended (as of NIAC2014) to use this attribute \t\t\trather than adding a signal attribute to the field. \t\t\tSee https://www.nexusformat.org/2014_How_to_find_default_data.html \t\t\tfor a summary of the discussion. \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsastof/ENTRY/sample" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsastof/ENTRY/instrument/detector/rotation_angle" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXinstrument/ATTENUATOR" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcrystal/azimuthal_angle" ; rdfs:comment """ Azimuthal angle at which crystal assembly is positioned. Note: it is recommended to use NXtransformations instead. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtomo/entry/instrument/detector" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXoff_geometry" ; rdfs:comment """ Geometry (shape) description. The format closely matches the Object File Format (OFF) which can be output by most CAD software. It can be used to describe the shape of any beamline component, including detectors. In the case of detectors it can be used to define the shape of a single pixel, or, if the pixel shapes are non-uniform, to describe the shape of the whole detector. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/partiality/description" ; rdfs:comment "Describes the dataset " ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/int_prf_var/description" ; rdfs:comment "Describes the dataset " ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcrystal/temperature" ; rdfs:comment "average/nominal crystal temperature" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcrystal/unit_cell_alpha" ; rdfs:comment "Unit cell lattice parameter: angle alpha" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXguide/coating_material" ; rdfs:comment "TODO: documentation needed" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXspe/ENTRY/INSTRUMENT" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/DETECTOR/angular_calibration" ; rdfs:comment "Angular calibration data." ; rdfs:seeAlso ; rdfs:subClassOf nxdetector:angular_calibration , . a rdfs:Class ; rdfs:label "NXvelocity_selector/wavelength_spread" ; rdfs:comment "deviation FWHM /Wavelength" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXfilter/temperature" ; rdfs:comment "average/nominal filter temperature" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXpolarizer" ; rdfs:comment """ A spin polarizer. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsource/power" ; rdfs:comment "Source power" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtofsingle/entry/MONITOR/time_of_flight" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXgrating/interior_atmosphere" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcapillary/TRANSFORMATIONS" ; rdfs:comment """ This is the group recommended for holding the chain of translation and rotation operations necessary to position the component within the instrument. The dependency chain may however traverse similar groups in other component groups. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXtofraw/entry/instrument/detector/azimuthal_angle" ; rdfs:comment "azimuthal angle for each detector element" ; rdfs:seeAlso ; rdfs:subClassOf nxdetector:azimuthal_angle , . a rdfs:Class ; rdfs:label "NXstxm/ENTRY/INSTRUMENT/monochromator" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXfresnel_zone_plate/focus_parameters" ; rdfs:comment """ \tlist of polynomial coefficients describing the focal length of the zone plate, in increasing powers of photon energy, \tthat describes the focal length of the zone plate (in microns) at an X-ray photon energy (in electron volts). """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsubentry/default" ; rdfs:comment """ \t\t\t.. index:: find the default plottable data \t\t\t.. index:: plotting \t\t\t.. index:: default attribute value \t\t\tDeclares which :ref:`NXdata` group contains the data \t\t\tto be shown by default. \t\t\tIt is used to resolve ambiguity when \t\t\tone :ref:`NXdata` group exists. \t\t\tThe value :ref:`names ` the default :ref:`NXentry` group. The \t\t\tvalue must be the name of a child of the current group. The child must be a \t\t\tNeXus group or a link to a NeXus group. \t\t\tFor more information about how NeXus identifies the default \t\t\tplottable data, see the \t\t\t:ref:`Find Plottable Data, v3 ` \t\t\tsection. \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdisk_chopper/delay" ; rdfs:comment """ \t\t\tTime difference between timing system t0 and chopper driving clock signal \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXfluo/entry/definition" ; rdfs:comment """ Official NeXus NXDL schema to which this file conforms. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXtomo/entry/sample" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/DETECTOR/DETECTOR_MODULE/fast_pixel_direction" ; rdfs:comment """ Values along the direction of :ref:`fastest varying ` pixel direction. The direction itself is given through the vector attribute. """ ; rdfs:seeAlso ; rdfs:subClassOf , . nxdetector:start_time a rdfs:Class ; rdfs:label "NXdetector/start_time" ; rdfs:comment "start time for each frame, with the ``start`` attribute as absolute reference" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxlaue/entry/instrument/source/distribution/wavelength" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXfilter/orientation_matrix" ; rdfs:comment """ \t\t\tOrientation matrix of single crystal filter using Busing-Levy convention: \t\t\tW. R. Busing and H. A. Levy (1967). Acta Cryst. 22, 457-464 \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsample/sample_component" ; rdfs:comment "Type of component" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXarchive/entry/start_time" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdisk_chopper/rotation_speed" ; rdfs:comment """ \t\t\tChopper rotation speed. Positive for anticlockwise rotation when \t\t\tfacing away from the source, negative otherwise. \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/DETECTOR/virtual_pixel_interpolation_applied" ; rdfs:comment """ True when virtual pixel interpolation has been applied, false otherwise. When virtual pixel interpolation is applied, values of some pixels may contain interpolated values. For example, to account for space between readout chips on a module, physical pixels on edges and corners between chips may have larger sensor areas and counts may be distributed between their logical pixels. """ ; rdfs:seeAlso ; rdfs:subClassOf nxdetector:virtual_pixel_interpolation_applied , . a rdfs:Class ; rdfs:label "NXfresnel_zone_plate/central_stop_diameter" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtomo/entry/data" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmonopd/entry/INSTRUMENT/SOURCE/probe" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXdata/offset" ; rdfs:comment """ \t\t\tAn optional offset to apply to the values in data. \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXrefscan/entry/instrument/DETECTOR" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXgrating/substrate_material" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXbeam_stop/depends_on" ; rdfs:comment """ NeXus positions components by applying a set of translations and rotations to apply to the component starting from 0, 0, 0. The order of these operations is critical and forms what NeXus calls a dependency chain. The depends_on field defines the path to the top most operation of the dependency chain or the string \".\" if located in the origin. Usually these operations are stored in a NXtransformations group. But NeXus allows them to be stored anywhere. The reference point of the beam stop is its center in the x and y axis. The reference point on the z axis is the surface of the beam stop pointing towards the source. .. image:: beam_stop/beam_stop.png :width: 40% """ ; rdfs:seeAlso ; rdfs:subClassOf . nxdetector:trigger_delay_time a rdfs:Class ; rdfs:label "NXdetector/trigger_delay_time" ; rdfs:comment """ Time it takes to start exposure after a trigger signal has been received. This is the reaction time of the detector firmware after receiving the trigger signal to when the detector starts to acquire the exposure, including any user set delay.. This is important to know for time resolved experiments. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsource/frequency" ; rdfs:comment "Frequency of pulsed source" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXenvironment/description" ; rdfs:comment "Description of the apparatus; e.g. 100mm bore orange cryostat with Roots pump" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXfresnel_zone_plate/support_membrane_thickness" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXentry/start_time" ; rdfs:comment "Starting time of measurement" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsource/number_of_bunches" ; rdfs:comment "For storage rings, the number of bunches in use." ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdetector_module/module_offset/offset_units" ; rdfs:comment """ \t\t\t\tUnits of the offset. \t\t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmonitor/nominal" ; rdfs:comment "Nominal reading to be used for normalisation purposes." ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmonochromator/wavelength" ; rdfs:comment "wavelength selected" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/int_prf/description" ; rdfs:comment "Describes the dataset " ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/DETECTOR/dead_time" ; rdfs:comment """ Detector dead time. """ ; rdfs:seeAlso ; rdfs:subClassOf nxdetector:dead_time , . a rdfs:Class ; rdfs:label "NXdetector" ; rdfs:comment """ A detector, detector bank, or multidetector. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxas/ENTRY/INSTRUMENT/monochromator" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXarpes/ENTRY/INSTRUMENT/analyser/acquisition_mode" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf nxdetector:acquisition_mode , . a rdfs:Class ; rdfs:label "NXvelocity_selector/length" ; rdfs:comment "rotor length" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsubentry/notes" ; rdfs:comment "Notes describing entry" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NeXusUnitCategory" ; rdfs:comment "Unit categories in NXDL specifications describe the expected type of units for a NeXus field.They should describe valid units consistent withthe manual section on NeXus units (based on UDUNITS).Units are not validated by NeXus." ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXguide/bend_angle_y" ; rdfs:comment "TODO: documentation needed" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcollimator/divergence_y" ; rdfs:comment "divergence of collimator in local y direction" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXevent_data/pulse_height" ; rdfs:comment """ \t\t\tIf voltages from the ends of the detector are read out this \t\t\tis where they go. This list is for all events with information \t\t\tto attach to a particular pulse height. The information to \t\t\tattach to a particular pulse is located in events_per_pulse. \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtas/entry/INSTRUMENT/monochromator/ei" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreftof/entry/instrument/detector/polar_angle" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXbending_magnet/accepted_photon_beam_divergence" ; rdfs:comment """ An array of four numbers giving X+, X-, Y+ and Y- half divergence """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdetector/data/long_name" ; rdfs:comment "Title of measurement" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXinsertion_device/poles" ; rdfs:comment "number of poles" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmonitor/distance" ; rdfs:comment "Distance of monitor from sample" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtas/entry/start_time" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsource/period" ; rdfs:comment "Period of pulsed source" ; rdfs:seeAlso ; rdfs:subClassOf . nxdetector:real_time a rdfs:Class ; rdfs:label "NXdetector/real_time" ; rdfs:comment """ Real-time of the exposure (use this if exposure time varies for each array element, otherwise use ``count_time`` field). \t Most often there is a single real time value that is constant across an entire image frame. In such cases, only a 1-D array is needed. But there are detectors in which the real time changes per pixel. In that case, more than one dimension is needed. Therefore the rank of this field should be less than or equal to (detector rank + 1). """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsample/BEAM" ; rdfs:comment "Details of beam incident on sample - used to calculate sample/beam interaction point" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXreflections" ; rdfs:comment "Reflection data from diffraction experiments " ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXlog/default" ; rdfs:comment """ .. index:: plotting Declares which child group contains a path leading to a :ref:`NXdata` group. It is recommended (as of NIAC2014) to use this attribute to help define the path to the default dataset to be plotted. See https://www.nexusformat.org/2014_How_to_find_default_data.html for a summary of the discussion. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/int_sum_errors" ; rdfs:comment """ The standard deviation of the estimate of the reflection intensity by summation """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/DETECTOR/count_time" ; rdfs:comment """ Elapsed actual counting time. """ ; rdfs:seeAlso ; rdfs:subClassOf nxdetector:count_time , . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/INSTRUMENT/SOURCE/radiation" ; rdfs:comment """ Name of the radiation used. Note that this is **not** the name of the facility! This field contains a value from either the ``probe`` or ``type`` fields in :ref:`NXsource`. Thus, it is redundant with existing NeXus structure. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/PROCESS/canSAS_class" ; rdfs:comment "Official canSAS group: :index:`NXcanSAS (applications); SASprocess`" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXroot/NX_class" ; rdfs:comment """ The root of any NeXus data file is an ``NXroot`` class (no other choice is allowed for a valid NeXus data file). This attribute cements that definition. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmonopd/entry" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXsas/ENTRY/INSTRUMENT/SOURCE" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtomo/entry/sample/rotation_angle" ; rdfs:comment """ \t\t In practice this axis is always aligned along one pixel direction on the detector and usually vertical. \t\t There are experiments with horizontal rotation axes, so this would need to be indicated somehow. \t\t For now the best way for that is an open question. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXoff_geometry/winding_order" ; rdfs:comment """ List of indices of vertices in the ``vertices`` dataset to form each face, right-hand rule for face normal. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsqom/ENTRY/reduction/input/filenames" ; rdfs:comment "Raw data files used to generate this I(Q)" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsas/ENTRY/INSTRUMENT/DETECTOR/azimuthal_angle" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsas/ENTRY/INSTRUMENT" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXreflections/observed_frame/description" ; rdfs:comment "Describes the dataset " ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXarchive/entry/collection_description" ; rdfs:comment "Brief summary of the collection, including grouping criteria " ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXtas/entry/DATA" ; rdfs:comment "One of the ei,ef,qh,qk,ql,en should get a primary=1 attribute to denote the main scan axis" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXpositioner/target_value" ; rdfs:comment "targeted (commanded) value of positioner - need [n] as may be scanned" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsas/ENTRY/INSTRUMENT/DETECTOR/aequatorial_angle" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/INSTRUMENT/SOURCE/beam_size_y" ; rdfs:comment "Size of the incident beam along the y axis." ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/SAMPLE/yaw" ; rdfs:comment "Rotation of the sample about the :math:`y` axis (yaw)" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsas/ENTRY/INSTRUMENT/DETECTOR/distance" ; rdfs:comment "The distance between detector and sample." ; rdfs:seeAlso ; rdfs:subClassOf nxdetector:distance , . a rdfs:Class ; rdfs:label "NXsample/OFF_GEOMETRY" ; rdfs:comment """ This group describes the shape of the sample """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXdirecttof/entry/title" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/BEAM/incident_wavelength_weights" ; rdfs:comment """ In the case of a polychromatic beam this is an array of length **m** of the relative weights of the corresponding wavelengths in ``incident_wavelength``. In the case of a polychromatic beam that varies shot-to- shot, this is a 2D array of dimensions **np** by **m** (slow to fast) of the relative weights of the corresponding wavelengths in ``incident_wavelength``. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/DETECTOR/DETECTOR_MODULE/data_stride" ; rdfs:comment """ Two or three values for the stride of the module in pixels in each direction. By default the stride is [1,1] or [1,1,1], and this is the most likely case. This optional field is included for completeness. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtas/entry/INSTRUMENT/DETECTOR" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdetector_module/fast_pixel_direction/depends_on" ; rdfs:comment """ \t\t\t\tPoints to the path of the next element in the geometry chain. \t\t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsample/unit_cell_volume" ; rdfs:comment "Volume of the unit cell" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsqom/ENTRY/reduction/program" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXlog/average_value" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . nxdetector:detector_readout_time a rdfs:Class ; rdfs:label "NXdetector/detector_readout_time" ; rdfs:comment """ Time it takes to read the detector (typically milliseconds). This is important to know for time resolved experiments. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXarchive/entry/sample/pressure" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXlog/cue_timestamp_zero/scaling_factor" ; rdfs:comment "If missing start is assumed to be the same as for \"time\"." ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXindirecttof" ; rdfs:comment "This is a application definition for raw data from a direct geometry TOF spectrometer" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtomoproc/entry/reconstruction/parameters" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsastof/ENTRY/instrument/detector/time_of_flight" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXfresnel_zone_plate/zone_material" ; rdfs:comment "Material of the zones themselves" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcrystal/depends_on" ; rdfs:comment """ NeXus positions components by applying a set of translations and rotations to apply to the component starting from 0, 0, 0. The order of these operations is critical and forms what NeXus calls a dependency chain. The depends_on field defines the path to the top most operation of the dependency chain or the string \".\" if located in the origin. Usually these operations are stored in a NXtransformations group. But NeXus allows them to be stored anywhere. .. todo:: Add a definition for the reference point of a crystal. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsubentry/INSTRUMENT" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxeuler" ; rdfs:comment """ raw data from a :index:`four-circle diffractometer` with an :index:`eulerian cradle`, extends :ref:`NXxbase` It extends :ref:`NXxbase`, so the full definition is the content of :ref:`NXxbase` plus the data defined here. All four angles are logged in order to support arbitrary scans in reciprocal space. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXbeam_stop/distance_to_detector" ; rdfs:comment """ distance of the beamstop to the detector. Note, it is recommended to use NXtransformations instead. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXarpes/ENTRY/INSTRUMENT/SOURCE/name" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxbase/entry/sample/y_translation" ; rdfs:comment "Translation of the sample along the Y-direction of the laboratory coordinate system" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXiqproc/ENTRY" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXsource/sigma_y" ; rdfs:comment "particle beam size in y" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxkappa/entry/definition" ; rdfs:comment " Official NeXus NXDL schema to which this file conforms " ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXtofsingle/entry/duration" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/INSTRUMENT/DETECTOR/y_pixel_size" ; rdfs:comment "Size of each detector pixel. If it is scalar all pixels are the same size" ; rdfs:seeAlso ; rdfs:subClassOf nxdetector:y_pixel_size , . a rdfs:Class ; rdfs:label "NXpositioner/description" ; rdfs:comment "description of positioner" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtomo/entry/start_time" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsastof/ENTRY/instrument/name" ; rdfs:comment "Name of the instrument actually used to perform the experiment" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXstxm/ENTRY/INSTRUMENT/sample_z" ; rdfs:comment " Measurements of the sample position from the z-axis interferometer." ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXfermi_chopper/radius" ; rdfs:comment "radius of chopper" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsample/path_length_window" ; rdfs:comment """ \t\t\tThickness of a beam entry/exit window on the can (mm) \t\t\t- assumed same for entry and exit \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtransformations/AXISNAME/equipment_component" ; rdfs:comment """ \t\t\t\tAn arbitrary identifier of a component of the equipment to which \t\t\t\tthe transformation belongs, such as 'detector_arm' or 'detector_module'. \t\t\t\tNXtransformations with the same equipment_component label form a logical \t\t\t\tgrouping which can be combined together into a single change-of-basis \t\t\t\toperation. \t\t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXuser/default" ; rdfs:comment """ .. index:: plotting Declares which child group contains a path leading to a :ref:`NXdata` group. It is recommended (as of NIAC2014) to use this attribute to help define the path to the default dataset to be plotted. See https://www.nexusformat.org/2014_How_to_find_default_data.html for a summary of the discussion. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXuser/ORCID" ; rdfs:comment """ \t\t\tan author code, Open Researcher and Contributor ID, \t\t\tdefined by https://orcid.org and expressed as a URI \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/DATA/mask" ; rdfs:comment """ Name of the data mask field. .. see: https://github.com/nexusformat/definitions/issues/533 The data *mask* must have the same shape as the *data* field. Positions in the mask correspond to positions in the *data* field. The value of the mask field may be either a boolean array where ``false`` means *no mask* and ``true`` means *mask* or a more descriptive array as as defined in :ref:`NXdetector`. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxas/ENTRY/INSTRUMENT/SOURCE/probe" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXreftof/entry/control/preset" ; rdfs:comment "preset value for time or monitor" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXstxm/ENTRY/INSTRUMENT/monochromator/energy" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXiqproc" ; rdfs:comment "Application definition for any :math:`I(Q)` data." ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXstxm/ENTRY/INSTRUMENT/sample_z/data" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsample/electric_field" ; rdfs:comment "Applied electric field" ; rdfs:seeAlso ; rdfs:subClassOf . nxdetector:countrate_correction_applied a rdfs:Class ; rdfs:label "NXdetector/countrate_correction_applied" ; rdfs:comment """ Counting detectors usually are not able to measure all incoming particles, especially at higher count-rates. Count-rate correction is applied to account for these errors. True when count-rate correction has been applied, false otherwise. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXgrating/OFF_GEOMETRY" ; rdfs:comment """ This group describes the shape of the beam line component """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXarpes/ENTRY/INSTRUMENT/analyser/pass_energy" ; rdfs:comment "energy of the electrons on the mean path of the analyser" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXpolarizer/depends_on" ; rdfs:comment """ NeXus positions components by applying a set of translations and rotations to apply to the component starting from 0, 0, 0. The order of these operations is critical and forms what NeXus calls a dependency chain. The depends_on field defines the path to the top most operation of the dependency chain or the string \".\" if located in the origin. Usually these operations are stored in a NXtransformations group. But NeXus allows them to be stored anywhere. .. todo:: Add a definition for the reference point of a polarizer. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXnote/type" ; rdfs:comment "Mime content type of note data field e.g. image/jpeg, text/plain, text/html" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXiqproc/ENTRY/instrument/name" ; rdfs:comment "Name of the instrument from which this data was reduced. " ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/DATA/timestamp" ; rdfs:comment """ ISO-8601 time [#iso8601]_ """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXbeam_stop/size" ; rdfs:comment """ Size of beamstop. If this is not sufficient to describe the beam stop use NXoff_geometry instead. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcrystal/d_spacing" ; rdfs:comment "spacing between crystal planes of the reflection" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtofraw" ; rdfs:comment "This is an application definition for raw data from a generic TOF instrument" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtomoproc/entry/INSTRUMENT" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXrefscan/entry/instrument/SOURCE" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/default" ; rdfs:comment """ .. index:: plotting Declares which child group contains a path leading to a :ref:`NXdata` group. It is recommended (as of NIAC2014) to use this attribute to help define the path to the default dataset to be plotted. See https://www.nexusformat.org/2014_How_to_find_default_data.html for a summary of the discussion. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcrystal/mosaic_horizontal" ; rdfs:comment "horizontal mosaic Full Width Half Maximum" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXiqproc/ENTRY/DATA" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/description" ; rdfs:comment "Describes the dataset " ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:comment "NeXus Group" ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXnote/sequence_index" ; rdfs:comment """ Sequence index of note, for placing a sequence of multiple **NXnote** groups in an order. Starts with 1. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxlaue/entry" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXroot" ; rdfs:comment "Definition of the root NeXus group." ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdetector/data/check_sum" ; rdfs:comment "Integral of data as check of data integrity" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:comment "NeXus concept" . a rdfs:Class ; rdfs:comment "NeXus Field" ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXguide/reflectivity/surface" ; rdfs:comment """ \t List of surfaces. Probably best to use index \t numbers but the specification is very loose. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXrefscan/entry/instrument/monochromator/wavelength" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcrystal/space_group" ; rdfs:comment "Space group of crystal structure" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/DETECTOR/DETECTOR_MODULE/slow_pixel_direction" ; rdfs:comment """ Values along the direction of :ref:`slowest varying ` pixel direction. The direction itself is given through the vector attribute. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXfilter/unit_cell_beta" ; rdfs:comment "Unit cell lattice parameter: angle beta" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/DETECTOR/DETECTOR_MODULE/module_offset/offset" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXrefscan/entry/control/mode" ; rdfs:comment """ Count to a preset value based on either clock time (timer) or received monitor counts (monitor). """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXfermi_chopper/distance" ; rdfs:comment "distance. Note, it is recommended to use NXtransformations instead." ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmirror/even_layer_density" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NX_ENERGY" ; rdfs:comment """ \t\t\t\tunits of energy \t\t\t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdetector/efficiency/wavelength" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxlaue" ; rdfs:comment """ raw data from a single crystal laue camera, extends :ref:`NXxrot` This is the application definition for raw data from a single crystal laue camera. It extends :ref:`NXxrot`. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXspe/ENTRY/data/polar" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXbeam_stop/GEOMETRY" ; rdfs:comment "engineering shape, orientation and position of the beam stop." ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXreflections/entering" ; rdfs:comment "Is the reflection entering or exiting the Ewald sphere " ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXguide/interior_atmosphere" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXbeam/extent" ; rdfs:comment """ Size of the beam entering this component. Note this represents a rectangular beam aperture, and values represent FWHM """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsastof/ENTRY/instrument/collimator/geometry/shape/size" ; rdfs:comment "The collimation length" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXfilter/sensor_type" ; rdfs:comment "Sensor(s)used to monitor the filter temperature" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXmx/ENTRY/SAMPLE/name" ; rdfs:comment "Descriptive name of sample" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXbeam/TRANSFORMATIONS/reference_plane/depends_on" ; rdfs:comment """ Points to the path to a field defining the location on which this depends or the string \".\" for origin. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXsastof/ENTRY/entry" ; rdfs:comment "NeXus convention is to use \"entry1\", \"entry2\", ... for analysis software to locate each entry" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXlog" ; rdfs:comment """ \t\tInformation recorded as a function of time. \t\tDescription of information that is recorded against \t\ttime. There are two common use cases for this: \t\t- When logging data such as temperature during a run \t\t- When data is taken in streaming mode data acquisition, \t\t i.e. just timestamp, value pairs are stored and \t\t correlated later in data reduction with other data, \t\tIn both cases, NXlog contains \t\tthe logged or streamed values and the times at which they were measured as elapsed time since a starting \t\ttime recorded in ISO8601 format. The time units are \t\tspecified in the units attribute. An optional scaling attribute \t\tcan be used to accomodate non standard clocks. \t\tThis method of storing logged data helps to distinguish instances in which a variable contains signal or \t\taxis coordinate values of plottable data, in which case it is stored \t\tin an :ref:`NXdata` group, and instances in which it is logged during the \t\trun, when it should be stored in an :ref:`NXlog` group. \t\tIn order to make random access to timestamped data faster there is an optional array pair of \t\t``cue_timestamp_zero`` and ``cue_index``. The ``cue_timestamp_zero`` will \t\tcontain coarser timestamps than in the time array, say \t\tevery five minutes. The ``cue_index`` will then contain the \t\tindex into the time,value pair of arrays for that \t\tcoarser ``cue_timestamp_zero``. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXuser/email" ; rdfs:comment "Email of user" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXfilter/density" ; rdfs:comment "mass density of the filter" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXroot/XML_version" ; rdfs:comment "Version of XML support library used in writing the XML file" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsensor/model" ; rdfs:comment "Sensor identification code/model number" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/SAMPLE" ; rdfs:comment """ Description of the sample. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXsastof/ENTRY/instrument/collimator/geometry" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXfluo/entry/INSTRUMENT/SOURCE" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXinsertion_device/type" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXgrating/duty_cycle" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtomo/entry/instrument/detector/image_key" ; rdfs:comment """ \t\t In order \t\t to distinguish between sample projections, dark and flat \t\t images, a magic number is recorded per frame. \t\t The key is as follows: \t\t * projection = 0 \t\t * flat field = 1 \t\t * dark field = 2 \t\t * invalid = 3 """ ; rdfs:seeAlso ; rdfs:subClassOf nxdetector:image_key , . a rdfs:Class ; rdfs:label "NXxeuler/entry/sample" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdetector/x_pixel_offset/long_name" ; rdfs:comment "x-axis offset from detector center" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXfermi_chopper/default" ; rdfs:comment """ .. index:: plotting Declares which child group contains a path leading to a :ref:`NXdata` group. It is recommended (as of NIAC2014) to use this attribute to help define the path to the default dataset to be plotted. See https://www.nexusformat.org/2014_How_to_find_default_data.html for a summary of the discussion. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXevent_data/cue_timestamp_zero" ; rdfs:comment """ \t Timestamps matching the corresponding cue_index into the \t event_id, event_time_offset pair. \t """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmirror/m_value" ; rdfs:comment """ The m value for a supermirror, which defines the supermirror regime in multiples of the critical angle of Nickel. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXparameters/term" ; rdfs:comment "A parameter (also known as a term) that is used in or results from processing." ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXindirecttof/entry/title" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreftof/entry/sample/name" ; rdfs:comment "Descriptive name of sample" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXcrystal/chemical_formula" ; rdfs:comment """ The chemical formula specified using CIF conventions. Abbreviated version of CIF standard: * Only recognized element symbols may be used. * Each element symbol is followed by a 'count' number. A count of '1' may be omitted. * A space or parenthesis must separate each cluster of (element symbol + count). * Where a group of elements is enclosed in parentheses, the multiplier for the group must follow the closing parentheses. That is, all element and group multipliers are assumed to be printed as subscripted numbers. * Unless the elements are ordered in a manner that corresponds to their chemical structure, the order of the elements within any group or moiety depends on whether or not carbon is present. * If carbon is present, the order should be: C, then H, then the other elements in alphabetical order of their symbol. If carbon is not present, the elements are listed purely in alphabetic order of their symbol. * This is the *Hill* system used by Chemical Abstracts. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdetector_group/group_type" ; rdfs:comment "Code number for group type, e.g. bank=1, tube=2 etc." ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/bounding_box/description" ; rdfs:comment "Describes the dataset " ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXinstrument/CRYSTAL" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtomo/entry/instrument/detector/y_pixel_size" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxraylens/cylindrical" ; rdfs:comment """ Is the device cylindrical? """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtomo/entry/end_time" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXarchive/entry/sample/sample_id" ; rdfs:comment "Unique database id of the sample" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtofraw/entry/instrument/detector/time_of_flight" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXbending_magnet" ; rdfs:comment "A bending magnet" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtomophase/entry/instrument" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXxkappa/entry/sample/kappa" ; rdfs:comment """ This is an array holding the kappa angle at each scan point """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxasproc/ENTRY/XAS_data_reduction/date" ; rdfs:comment "Date and time of reconstruction processing." ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXdirecttof/entry/INSTRUMENT/disk_chopper/energy" ; rdfs:comment "energy selected" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXindirecttof/entry/INSTRUMENT/analyser/distance" ; rdfs:comment "distance from sample" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/DETECTOR/flatfield_error" ; rdfs:comment """ *** Deprecated form. Use plural form *** Errors of the flat field correction data. If provided, it is recommended that it be compressed. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsensor/low_trip_value" ; rdfs:comment """ \t\t\tLower control bound of sensor reading if using run_control \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxlaueplate/entry/instrument/detector" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/observed_x/description" ; rdfs:comment "Describes the dataset " ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcapillary/focal_size" ; rdfs:comment """ The focal size in FWHM """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsqom/ENTRY/instrument" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXgrating/shape" ; rdfs:comment "A NXshape group describing the shape of the mirror" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXuser/affiliation" ; rdfs:comment "Affiliation of user" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXfilter/OFF_GEOMETRY" ; rdfs:comment """ This group describes the shape of the beam line component """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/BEAM/incident_wavelength_spectrum" ; rdfs:comment """ This group is intended for use cases that do not fit the :ref:`incident_wavelength ` and :ref:`incident_wavelength_weights ` fields above, perhaps for example a 2D spectrometer. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXxbase/entry/instrument/monochromator/wavelength" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsas/ENTRY/MONITOR" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdisk_chopper/top_dead_center" ; rdfs:comment """ \t\t\tTimestamps of the top-dead-center signal. The times are relative \t\t\tto the \"start\" attribute and in the units specified in the \"units\" \t\t\tattribute. Please note that absolute \t\t\ttimestamps under unix are relative to ``1970-01-01T00:00:00.0Z``. \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXpositioner/controller_record" ; rdfs:comment "Hardware device record, e.g. EPICS process variable, taco/tango ..." ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsample/path_length" ; rdfs:comment """ \t\t\tPath length through sample/can for simple case when \t\t\tit does not vary with scattering direction \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXroot/file_name" ; rdfs:comment "File name of original NeXus file" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxbase/entry/start_time" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXarchive/entry/user/role" ; rdfs:comment "role of the user" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/DETECTOR/countrate_correction_lookup_table" ; rdfs:comment """ The countrate_correction_lookup_table defines the LUT used for count-rate correction. It maps a measured count :math:`c` to its corrected value :math:`countrate\\_correction\\_lookup\\_table[c]`. :math:`m` denotes the length of the table. """ ; rdfs:seeAlso ; rdfs:subClassOf nxdetector:countrate_correction_lookup_table , . a rdfs:Class ; rdfs:label "NXreflections/observed_px_x_var" ; rdfs:comment """ The variance on the estimate of the pixel x position at which the central impact of the reflection was recorded """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtomo/entry/definition" ; rdfs:comment " Official NeXus NXDL schema to which this file conforms " ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXreflections/predicted_phi/description" ; rdfs:comment "Describes the dataset " ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXinsertion_device/depends_on" ; rdfs:comment """ NeXus positions components by applying a set of translations and rotations to apply to the component starting from 0, 0, 0. The order of these operations is critical and forms what NeXus calls a dependency chain. The depends_on field defines the path to the top most operation of the dependency chain or the string \".\" if located in the origin. Usually these operations are stored in a NXtransformations group. But NeXus allows them to be stored anywhere. .. todo:: Add a definition for the reference point of a insertion device. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/observed_px_y" ; rdfs:comment """ The estimate of the pixel y position at which the central impact of the reflection was recorded """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXinsertion_device" ; rdfs:comment "An insertion device, as used in a synchrotron light source." ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtomoproc/entry/reconstruction" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXdetector_module/module_offset" ; rdfs:comment """ \t\t\tOffset of the module in regards to the origin of the detector in an \t\t\tarbitrary direction. \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/flags" ; rdfs:comment """ Status flags describing the reflection. This is a bit mask. The bits in the mask follow the convention used by DIALS, and have the following names: === ========================================== bit name === ========================================== 0 ``predicted`` 1 ``observed`` 2 ``indexed`` 3 ``used_in_refinement`` 4 ``strong`` 5 ``reference_spot`` 6 ``dont_integrate`` 7 ``integrated_sum`` 8 ``integrated_prf`` 9 ``integrated`` 10 ``overloaded`` 11 ``overlapped`` 12 ``overlapped_fg`` 13 ``in_powder_ring`` 14 ``foreground_includes_bad_pixels`` 15 ``background_includes_bad_pixels`` 16 ``includes_bad_pixels`` 17 ``bad_shoebox`` 18 ``bad_spot`` 19 ``used_in_modelling`` 20 ``centroid_outlier`` 21 ``failed_during_background_modelling`` 22 ``failed_during_summation`` 23 ``failed_during_profile_fitting`` 24 ``bad_reference`` === ========================================== """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXbeam_stop/y" ; rdfs:comment """ y position of the beamstop in relation to the detector. Note, it is recommended to use NXtransformations instead. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtomo/entry/instrument/detector/data" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmonitor/end_time" ; rdfs:comment "Ending time of measurement" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXorientation" ; rdfs:comment """ legacy class - recommend to use :ref:`NXtransformations` now Description for a general orientation of a component - used by :ref:`NXgeometry` """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsample/scattering_length_density" ; rdfs:comment "Scattering length density of each component" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXstxm/ENTRY/start_time" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXvelocity_selector/TRANSFORMATIONS" ; rdfs:comment """ This is the group recommended for holding the chain of translation and rotation operations necessary to position the component within the instrument. The dependency chain may however traverse similar groups in other component groups. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXreflections/observed_px_y_errors" ; rdfs:comment """ The standard deviation of the estimate of the pixel y position at which the central impact of the reflection was recorded """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxlaueplate/entry/instrument" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXaperture" ; rdfs:comment """ A beamline aperture. Note, the group was incorrectly documented as deprecated, but it is not and it is in common use.""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcrystal/unit_cell_gamma" ; rdfs:comment "Unit cell lattice parameter: angle gamma" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsource" ; rdfs:comment "The neutron or x-ray storage ring/facility." ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXrefscan/entry/instrument/SOURCE/probe" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXdisk_chopper/slit_angle" ; rdfs:comment "Angular opening" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXfresnel_zone_plate/central_stop_thickness" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXspe/ENTRY/INSTRUMENT/FERMI_CHOPPER/energy" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdata/AXISNAME/long_name" ; rdfs:comment "Axis label" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NX_PRESSURE" ; rdfs:comment """ \t\t\t\tunits of pressure \t\t\t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/DETECTOR/angular_calibration_applied" ; rdfs:comment """ True when the angular calibration has been applied in the electronics, false otherwise. """ ; rdfs:seeAlso ; rdfs:subClassOf nxdetector:angular_calibration_applied , . a rdfs:Class ; rdfs:label "NXsas/ENTRY/INSTRUMENT/DETECTOR/beam_center_y" ; rdfs:comment """ This is the y position where the direct beam would hit the detector. This is a length, not a pixel position, and can be outside of the actual detector. It is expected that data reduction will determine beam center from the raw data, thus it is not required here. The instrument can provide an initial or nominal value to advise data reduction. """ ; rdfs:seeAlso ; rdfs:subClassOf nxdetector:beam_center_y , . a rdfs:Class ; rdfs:label "NXguide/reflectivity/data" ; rdfs:comment "reflectivity of each surface as a function of wavelength" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/SAMPLE/y_position" ; rdfs:comment "Location of the sample in :math:`y`" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsensor/value" ; rdfs:comment """ \t\t\tnominal setpoint or average value \t\t\t- need [n] as may be a vector \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdisk_chopper/slits" ; rdfs:comment "Number of slits" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcrystal/type" ; rdfs:comment """ Type or material of monochromating substance. Chemical formula can be specified separately. Use the \"reflection\" field to indicate the (hkl) orientation. Use the \"d_spacing\" field to record the lattice plane spacing. This field was changed (2010-11-17) from an enumeration to a string since common usage showed a wider variety of use than a simple list. These are the items in the list at the time of the change: PG (Highly Oriented Pyrolytic Graphite) | Ge | Si | Cu | Fe3Si | CoFe | Cu2MnAl (Heusler) | Multilayer | Diamond. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsensor/value_log" ; rdfs:comment "Time history of sensor readings" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXcrystal/OFF_GEOMETRY" ; rdfs:comment """ This group describes the shape of the beam line component """ ; rdfs:seeAlso ; rdfs:subClassOf , . nxdetector:image_key a rdfs:Class ; rdfs:label "NXdetector/image_key" ; rdfs:comment """ This field allow to distinguish different types of exposure to the same detector \"data\" field. Some techniques require frequent (re-)calibration inbetween measuremnts and this way of recording the different measurements preserves the chronological order with is important for correct processing. This is used for example in tomography (`:ref:`NXtomo`) sample projections, dark and flat images, a magic number is recorded per frame. The key is as follows: * projection (sample) = 0 * flat field = 1 * dark field = 2 * invalid = 3 * background (no sample, but buffer where applicable) = 4 In cases where the data is of type :ref:`NXlog` this can also be an NXlog. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXbeam/DATA" ; rdfs:comment """ Distribution of beam with respect to relevant variable e.g. wavelength. This is mainly useful for simulations which need to store plottable information at each beamline component.""" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXreflections/observed_px_x_errors/description" ; rdfs:comment "Describes the dataset " ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/name" ; rdfs:comment """ Name of instrument. Consistency with the controlled vocabulary beamline naming in https://mmcif.wwpdb.org/dictionaries/mmcif_pdbx_v50.dic/Items/_diffrn_source.pdbx_synchrotron_beamline.html and https://mmcif.wwpdb.org/dictionaries/mmcif_pdbx_v50.dic/Items/_diffrn_source.type.html is highly recommended. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXflipper" ; rdfs:comment "A spin flipper." ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsubentry/definition_local/version" ; rdfs:comment "NXDL version number" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtomoproc/entry/reconstruction/parameters/raw_file" ; rdfs:comment "Original raw data file this data was derived from" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsqom/ENTRY/instrument/SOURCE/type" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXcrystal/bragg_angle" ; rdfs:comment "Bragg angle of nominal reflection" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXvelocity_selector/default" ; rdfs:comment """ .. index:: plotting Declares which child group contains a path leading to a :ref:`NXdata` group. It is recommended (as of NIAC2014) to use this attribute to help define the path to the default dataset to be plotted. See https://www.nexusformat.org/2014_How_to_find_default_data.html for a summary of the discussion. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreftof/entry/instrument/detector" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/observed_frame_errors" ; rdfs:comment """ The standard deviation of the estimate of the frame at which the central impact of the reflection was recorded """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/TRANSMISSION_SPECTRUM/T" ; rdfs:comment """ Transmission values (:math:`I/I_0`) as a function of wavelength. This array is of the same shape as ``lambda`` and ``Tdev``. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXgrating/diffraction_order" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdetector_group/group_names" ; rdfs:comment """ \t\t\tAn array of the names of the detectors given in NXdetector \t\t\tgroups or the names of hierarchical groupings of detectors \t\t\tgiven as names of NXdetector_group groups or in \t\t\tNXdetector_group group_names and group_parent fields as \t\t\thaving children. \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxbase/entry/sample/orientation_matrix" ; rdfs:comment """ The orientation matrix according to Busing and Levy conventions. This is not strictly necessary as the UB can always be derived from the data. But let us bow to common usage which includes the UB nearly always. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXtofnpd/entry/INSTRUMENT/detector/data" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXindirecttof/entry" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXroot/file_time" ; rdfs:comment "Date and time file was originally created" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXprocess/sequence_index" ; rdfs:comment """ Sequence index of processing, for determining the order of multiple **NXprocess** steps. Starts with 1. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsource/mode" ; rdfs:comment "source operating mode" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdetector/input/local_name" ; rdfs:comment "Equivalent local term" ; rdfs:seeAlso ; rdfs:subClassOf . nxdetector:z_pixel_offset a rdfs:Class ; rdfs:label "NXdetector/z_pixel_offset" ; rdfs:comment """ Offset from the detector center in the z-direction. Can be multidimensional when different values are required for each pixel. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreftof/entry/start_time" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcrystal/segment_width" ; rdfs:comment "Horizontal width of individual segment" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/reflection_id/description" ; rdfs:comment "Describes the dataset " ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXinstrument/MIRROR" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsensor/depends_on" ; rdfs:comment """ NeXus positions components by applying a set of translations and rotations to apply to the component starting from 0, 0, 0. The order of these operations is critical and forms what NeXus calls a dependency chain. The depends_on field defines the path to the top most operation of the dependency chain or the string \".\" if located in the origin. Usually these operations are stored in a NXtransformations group. But NeXus allows them to be stored anywhere. .. todo:: Add a definition for the reference point of a sensor. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsubentry/experiment_description" ; rdfs:comment "Brief summary of the experiment, including key objectives." ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsource/type" ; rdfs:comment "type of radiation source (pick one from the enumerated list and spell exactly)" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXfermi_chopper/energy" ; rdfs:comment "energy selected" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcrystal/temperature_coefficient" ; rdfs:comment "how lattice parameter changes with temperature" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXentry/SUBENTRY" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXarchive/entry/user/facility_user_id" ; rdfs:comment "ID of the user in the facility burocracy database" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXdetector_module/fast_pixel_direction/offset_units" ; rdfs:comment """ \t\t\t\tUnits of the offset. \t\t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsource/energy" ; rdfs:comment """ \t\t\tSource energy. \t\t\tFor storage rings, this would be the particle beam energy. \t\t\tFor X-ray tubes, this would be the excitation voltage. \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXfresnel_zone_plate/default" ; rdfs:comment """ .. index:: plotting Declares which child group contains a path leading to a :ref:`NXdata` group. It is recommended (as of NIAC2014) to use this attribute to help define the path to the default dataset to be plotted. See https://www.nexusformat.org/2014_How_to_find_default_data.html for a summary of the discussion. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcylindrical_geometry/cylinders" ; rdfs:comment """ List of indices of vertices in the ``vertices`` dataset to form each cylinder. Each cylinder is described by three vertices A, B, C. First vertex A lies on the cylinder axis and circular face, second point B on edge of the same face as A, and third point C at the other face and on axis. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsas/ENTRY/INSTRUMENT/DETECTOR/polar_angle" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtomoproc/entry/INSTRUMENT/SOURCE/name" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . nxdetector:description a rdfs:Class ; rdfs:label "NXdetector/description" ; rdfs:comment "name/manufacturer/model/etc. information" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXpositioner/tolerance" ; rdfs:comment "maximum allowable difference between target_value and value" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXvelocity_selector/spwidth" ; rdfs:comment "spoke width at beam centre" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcrystal/usage" ; rdfs:comment "How this crystal is used. Choices are in the list." ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdisk_chopper/phase" ; rdfs:comment "Chopper phase angle" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/DATA" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXarpes/ENTRY/definition" ; rdfs:comment "Official NeXus NXDL schema to which this file conforms." ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXinstrument/COLLECTION" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxas/ENTRY/title" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmonopd" ; rdfs:comment """ Monochromatic Neutron and X-Ray Powder diffractometer Instrument definition for a powder diffractometer at a monochromatic neutron or X-ray beam. This is both suited for a powder diffractometer with a single detector or a powder diffractometer with a position sensitive detector. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXfilter/unit_cell_b" ; rdfs:comment "Unit cell lattice parameter: length of side b" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsensor/attached_to" ; rdfs:comment "where sensor is attached to (\"sample\" | \"can\")" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtofsingle/entry/INSTRUMENT/detector/time_of_flight" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtomophase/entry/instrument/dark_field/sequence_number" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXstxm/ENTRY/INSTRUMENT/DETECTOR" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXinstrument/CAPILLARY" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtomophase/entry/instrument/SOURCE/name" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXbeam/TRANSFORMATIONS/reference_plane/offset" ; rdfs:comment """ Not required as beam direction offset locates the plane """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXarchive/entry/instrument/SOURCE" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsample/ub_matrix" ; rdfs:comment """ \t\t\tUB matrix of single crystal sample using Busing-Levy convention: \t\t\tW. R. Busing and H. A. Levy (1967). Acta Cryst. 22, 457-464. This is \t\t\tthe multiplication of the orientation_matrix, given above, \t\t\twith the :math:`B` matrix which \t\t\tcan be derived from the lattice constants. \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/DATA/canSAS_class" ; rdfs:comment "Official canSAS group: :index:`NXcanSAS (applications); SASdata`" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXfermi_chopper/TRANSFORMATIONS" ; rdfs:comment """ This is the group recommended for holding the chain of translation and rotation operations necessary to position the component within the instrument. The dependency chain may however traverse similar groups in other component groups. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXmx/ENTRY/SOURCE/name" ; rdfs:comment """ Name of source. Consistency with the naming in https://mmcif.wwpdb.org/dictionaries/mmcif_pdbx_v50.dic/Items/_diffrn_source.pdbx_synchrotron_site.html controlled vocabulary is highly recommended. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXenvironment/TRANSFORMATIONS" ; rdfs:comment """ This is the group recommended for holding the chain of translation and rotation operations necessary to position the component within the instrument. The dependency chain may however traverse similar groups in other component groups. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXslit/default" ; rdfs:comment """ .. index:: plotting Declares which child group contains a path leading to a :ref:`NXdata` group. It is recommended (as of NIAC2014) to use this attribute to help define the path to the default dataset to be plotted. See https://www.nexusformat.org/2014_How_to_find_default_data.html for a summary of the discussion. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/predicted_px_x/description" ; rdfs:comment "Describes the dataset " ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmonopd/entry/SAMPLE/rotation_angle" ; rdfs:comment """ Optional rotation angle for the case when the powder diagram has been obtained through an omega-2theta scan like from a traditional single detector powder diffractometer """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXiqproc/ENTRY/title" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXfilter" ; rdfs:comment """ \t\tFor band pass beam filters. \t\t \t\tIf uncertain whether to use :ref:`NXfilter` (band-pass filter) \t\tor :ref:`NXattenuator` (reduces beam intensity), then use \t\t:ref:`NXattenuator`. \t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXentry/MONITOR" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXentry/definition/URL" ; rdfs:comment "URL of NXDL file" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsensor/high_trip_value" ; rdfs:comment """ \t\t\tUpper control bound of sensor reading if using run_control \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmirror/even_layer_material" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreftof/entry/control" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsample/preparation_date" ; rdfs:comment "Date of preparation of the sample" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmirror/substrate_density" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/DATA/Qdev/units" ; rdfs:comment """ Engineering units to use when expressing :math:`Q` and related terms. Data expressed in other units may not be processed by some software packages. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsqom/ENTRY/instrument/SOURCE/name" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtofraw/entry/instrument" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXdata/AXISNAME/distribution" ; rdfs:comment """ \t\t\t\t``0|false``: single value, \t\t\t\t``1|true``: multiple values \t\t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXentry/experiment_documentation" ; rdfs:comment "Description of the full experiment (document in pdf, latex, ...)" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXsensor/type" ; rdfs:comment """ \t\t\tThe type of hardware used for the measurement. \t\t\tExamples (suggestions but not restrictions): \t\t\t \t\t\t:Temperature: \t\t\t J | K | T | E | R | S | Pt100 | Rh/Fe \t\t\t:pH: \t\t\t Hg/Hg2Cl2 | Ag/AgCl | ISFET \t\t\t:Ion selective electrode: \t\t\t specify species; e.g. Ca2+ \t\t\t:Magnetic field: \t\t\t Hall \t\t\t:Surface pressure: \t\t\t wilhelmy plate \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXfluo/entry/SAMPLE/name" ; rdfs:comment "Descriptive name of sample" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXinsertion_device/magnetic_wavelength" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxas/ENTRY/SAMPLE" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/DETECTOR/flatfield" ; rdfs:comment """ Flat field correction data. If provided, it is recommended that it be compressed. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsastof/ENTRY/control/data" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcrystal/default" ; rdfs:comment """ .. index:: plotting Declares which child group contains a path leading to a :ref:`NXdata` group. It is recommended (as of NIAC2014) to use this attribute to help define the path to the default dataset to be plotted. See https://www.nexusformat.org/2014_How_to_find_default_data.html for a summary of the discussion. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NX_PCOMPLEX" ; rdfs:comment """ \t\t\t\tCompound type polar representation of complex numbers \t\t\t\t(amplitude and phase *in radians*) in NeXus. \t\t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXarchive/entry/instrument/name" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXenvironment/SENSOR" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdirecttof/entry/start_time" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/overlaps/description" ; rdfs:comment "Describes the dataset " ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXfermi_chopper/wavelength" ; rdfs:comment "Wavelength transmitted by chopper" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsource/bunch_pattern/title" ; rdfs:comment "name of the bunch pattern" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NX_CHARGE" ; rdfs:comment """ \t\t\t\tunits of electrical charge \t\t\t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NX_TIME" ; rdfs:comment """ \t\t\t\tunits of time \t\t\t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxkappa/entry" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXpinhole/depends_on" ; rdfs:comment """ \t\t\tPoints to the path of the last element in the geometry chain that places \t\t\tthis object in space. \t\t\tWhen followed through that chain is supposed to end at an element depending \t\t\ton \".\" i.e. the origin of the coordinate system. \t\t\tIf desired the location of the slit can also be described relative to \t\t\tan NXbeam, which will allow a simple description of a non-centred pinhole. \t\t\tThe reference direction of the pinhole is parallel with the z axis. The reference \t\t\tpoint of the pinhole is its center in the x and y axis. The reference point on the z axis is the \t\t\tplane which overlaps the side of the opening of the pin hole pointing towards the source (minus on the z axis). \t\t\t.. image:: pinhole/pinhole.png \t\t\t\t:width: 40% \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXbeam/TRANSFORMATIONS/DIRECTION" ; rdfs:comment """ Direction of beam vector, its value is ignored. If missing, then the beam direction is defined as [0,0,1] and passes through the origin """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXlauetof/entry/instrument/detector/distance" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXguide/external_material" ; rdfs:comment "external material outside substrate" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXrefscan/entry/end_time" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtofraw/entry/run_number" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdetector_channel/pixel_mask" ; rdfs:comment """ Custom pixel mask for this channel. May include nP as the first dimension for masks that vary for each scan point. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdata/auxiliary_signals" ; rdfs:comment """ \t\t\t.. index:: plotting \t\t\t \t\t\tArray of strings holding the :ref:`names ` of additional \t\t\tsignals to be plotted with the :ref:`default signal `. \t\t\tThese fields or links *must* exist and be direct children of this NXdata group. \t\t\t \t\t\tEach auxiliary signal needs to be of the same shape as the default signal. \t\t\t \t\t\t.. NIAC2018: \t\t\t https://www.nexusformat.org/NIAC2018Minutes.html \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXrefscan/entry/instrument/DETECTOR/polar_angle" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxbase/entry/instrument/monochromator" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtofnpd/entry/pre_sample_flightpath" ; rdfs:comment """ This is the flight path before the sample position. This can be determined by a chopper, by the moderator or the source itself. In other words: it the distance to the component which gives the T0 signal to the detector electronics. If another component in the NXinstrument hierarchy provides this information, this should be a link. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/DATA/Mask_indices" ; rdfs:comment """ Integer or integer array that describes which indices (of the :math:`I` data object) are used to reference the ``Mask`` data object. The items in this array use zero-based indexing. Such as:: @Mask_indices=3,4 which indicates that Q requires two indices from the :math:`I` data object for Q position. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXentry" ; rdfs:comment """ \t\t(**required**) :ref:`NXentry` describes the measurement. \t\tThe top-level NeXus group which contains all the data and associated \t\tinformation that comprise a single measurement. \t\tIt is mandatory that there is at least one \t\tgroup of this type in the NeXus file.\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXentry/features" ; rdfs:comment """ \t\t\tReserved for future use by NIAC. \t\t\tSee https://github.com/nexusformat/definitions/issues/382 \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsample_component/space_group" ; rdfs:comment "Crystallographic space group" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXindirecttof/entry/INSTRUMENT" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXarpes/ENTRY/entry" ; rdfs:comment """ NeXus convention is to use \"entry1\", \"entry2\", ... for analysis software to locate each entry. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXstxm/ENTRY/control" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXpinhole/default" ; rdfs:comment """ .. index:: plotting Declares which child group contains a path leading to a :ref:`NXdata` group. It is recommended (as of NIAC2014) to use this attribute to help define the path to the default dataset to be plotted. See https://www.nexusformat.org/2014_How_to_find_default_data.html for a summary of the discussion. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtomo/entry" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXscan" ; rdfs:comment """ Application definition for a generic scan instrument. This definition is more an example then a stringent definition as the content of a given NeXus scan file needs to differ for different types of scans. This example definition shows a scan like done on a rotation camera: the sample is rotated and a detector image, the rotation angle and a monitor value is stored at each step in the scan. In the following, the symbol ``NP`` is used to represent the number of scan points. These are the rules for storing scan data in NeXus files which are implemented in this example: * Each value varied throughout a scan is stored as an array of length ``NP`` at its respective location within the NeXus hierarchy. * For area detectors, ``NP`` is the first dimension, example for a detector of 256x256: ``data[NP,256,256]`` * The NXdata group contains links to all variables varied in the scan and the data. This to give an equivalent to the more familiar classical tabular representation of scans. These rules exist for a reason: HDF allows the first dimension of a data set to be unlimited. This means the data can be appended too. Thus a NeXus file built according to the rules given above can be used in the following way: * At the start of a scan, write all the static information. * At each scan point, append new data from varied variables and the detector to the file. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/int_prf" ; rdfs:comment """ The estimate of the reflection intensity by profile fitting """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdetector_module/fast_pixel_direction/transformation_type" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxkappa/entry/sample/phi" ; rdfs:comment """ This is an array holding the phi angle at each scan point """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXiqproc/ENTRY/DATA/data" ; rdfs:comment """ This is I(Q). The client has to analyse the dimensions of I(Q). Often, multiple I(Q) for various environment conditions are measured; that would be the first dimension. Q can be multidimensional, this accounts for the further dimensions in the data """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxas/ENTRY/DATA/mode" ; rdfs:comment "Detection method used for observing the sample absorption (pick one from the enumerated list and spell exactly)" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsas/ENTRY/MONITOR/preset" ; rdfs:comment "Preset value for time or monitor." ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmirror/type" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXorientation/default" ; rdfs:comment """ .. index:: plotting Declares which child group contains a path leading to a :ref:`NXdata` group. It is recommended (as of NIAC2014) to use this attribute to help define the path to the default dataset to be plotted. See https://www.nexusformat.org/2014_How_to_find_default_data.html for a summary of the discussion. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtomo/entry/instrument/SOURCE/type" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXsastof/ENTRY/instrument/detector/azimuthal_angle" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/run" ; rdfs:comment """ Run identification for this *SASentry*. For many facilities, this is an integer, such as en experiment number. Use multiple instances of ``run`` as needed, keeping in mind that HDF5 requires unique names for all entities in a group. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXvelocity_selector/depends_on" ; rdfs:comment """ NeXus positions components by applying a set of translations and rotations to apply to the component starting from 0, 0, 0. The order of these operations is critical and forms what NeXus calls a dependency chain. The depends_on field defines the path to the top most operation of the dependency chain or the string \".\" if located in the origin. Usually these operations are stored in a NXtransformations group. But NeXus allows them to be stored anywhere. .. todo:: Add a definition for the reference point of a velocity selector. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdetector/x_pixel_offset/primary" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . nxdetector:data a rdfs:Class ; rdfs:label "NXdetector/data" ; rdfs:comment """ Data values from the detector. The rank and dimension ordering should follow a principle of slowest to fastest measurement axes and may be explicitly specified in application definitions. Mechanical scanning of objects (e.g. sample position/angle, incident beam energy, etc) tends to be the slowest part of an experiment and so any such scan axes should be allocated to the first dimensions of the array. Note that in some cases it may be useful to represent a 2D set of scan points as a single scan-axis in the data array, especially if the scan pattern doesn't fit a rectangular array nicely. Repetition of an experiment in a time series tends to be used similar to a slow scan axis and so will often be in the first dimension of the data array. The next fastest axes are typically the readout of the detector. A point detector will not add any dimensions (as it is just a single value per scan point) to the data array, a strip detector will add one dimension, an imaging detector will add two dimensions (e.g. X, Y axes) and detectors outputting higher dimensional data will add the corresponding number of dimensions. Note that the detector dimensions don't necessarily have to be written in order of the actual readout speeds - the slowest to fastest rule principle is only a guide. Finally, detectors that operate in a time-of-flight mode, such as a neutron spectrometer or a silicon drift detector (used for X-ray fluorescence) tend to have their dimension(s) added to the last dimensions in the data array. The type of each dimension should should follow the order of scan points, detector pixels, then time-of-flight (i.e. spectroscopy, spectrometry). The rank and dimension sizes (see symbol list) shown here are merely illustrative of coordination between related datasets. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxraylens/depends_on" ; rdfs:comment """ NeXus positions components by applying a set of translations and rotations to apply to the component starting from 0, 0, 0. The order of these operations is critical and forms what NeXus calls a dependency chain. The depends_on field defines the path to the top most operation of the dependency chain or the string \".\" if located in the origin. Usually these operations are stored in a NXtransformations group. But NeXus allows them to be stored anywhere. .. todo:: Add a definition for the reference point of a x-ray lens. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXindirecttof/entry/definition" ; rdfs:comment " Official NeXus NXDL schema to which this file conforms " ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXtofsingle/entry/MONITOR" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXstxm/ENTRY/DATA/sample_y" ; rdfs:comment """ List of Y positions on the sample. If scanned through multiple values, then an 'axis' attribute will be required to link the field to the appropriate data array dimension.""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXfilter/unit_cell_gamma" ; rdfs:comment "Unit cell lattice parameter: angle gamma" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXbending_magnet/divergence_y_minus" ; rdfs:comment """ Accepted photon beam divergence in Y- (vertical downward) direction. Note that divergence_y_plus+divergence_y_minus is the total vertical beam divergence. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsqom/ENTRY/reduction" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXbeam/distance" ; rdfs:comment "Distance from sample. Note, it is recommended to use NXtransformations instead." ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXentry/collection_description" ; rdfs:comment "Brief summary of the collection, including grouping criteria." ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtomoproc/entry/data/x" ; rdfs:comment """ This is an array holding the values to use for the x-axis of data. The units must be appropriate for the measurement. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXreflections/int_sum/description" ; rdfs:comment "Describes the dataset " ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdetector_group/group_parent" ; rdfs:comment """ \t\t\tAn array of the hierarchical levels of the parents of detectors \t\t\tor groupings of detectors. \t\t\t \t\t\tA top-level grouping has parent level -1.""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXlauetof/entry/name" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/DETECTOR/distance" ; rdfs:comment """ Distance from the sample to the beam center. Normally this value is for guidance only, the proper geometry can be found following the depends_on axis chain, But in appropriate cases where the dectector distance to the sample is observable independent of the axis chain, that may take precedence over the axis chain calculation. """ ; rdfs:seeAlso ; rdfs:subClassOf nxdetector:distance , . a rdfs:Class ; rdfs:label "NXiqproc/ENTRY/DATA/variable/varied_variable" ; rdfs:comment "The real name of the varied variable in the first dim of data, temperature, P, MF etc..." ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtofraw/entry/MONITOR/integral_counts" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsubentry/revision" ; rdfs:comment """ \t\t\tRevision id of the file due to re-calibration, reprocessing, new analysis, new \t\t\tinstrument definition format, ... \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXflipper/guide_current" ; rdfs:comment "Guide field coil current in \"on\" state" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/INSTRUMENT/DETECTOR/name" ; rdfs:comment "Identifies the name of this detector" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxkappa/entry/instrument" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmonochromator/GRATING" ; rdfs:comment "For diffraction grating based monochromators" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXsubentry/program_name" ; rdfs:comment "Name of program used to generate this file" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/DETECTOR/type" ; rdfs:comment """ Description of type such as scintillator, ccd, pixel, image plate, CMOS, ... """ ; rdfs:seeAlso ; rdfs:subClassOf nxdetector:type , . a rdfs:Class ; rdfs:label "NXlauetof/entry/sample/orientation_matrix" ; rdfs:comment """ The orientation matrix according to Busing and Levy conventions. This is not strictly necessary as the UB can always be derived from the data. But let us bow to common usage which includes thie UB nearly always. \t """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXfresnel_zone_plate" ; rdfs:comment "A fresnel zone plate" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXpositioner/TRANSFORMATIONS" ; rdfs:comment """ This is the group recommended for holding the chain of translation and rotation operations necessary to position the component within the instrument. The dependency chain may however traverse similar groups in other component groups. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXreflections/id/description" ; rdfs:comment "Describes the dataset " ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsas/ENTRY/INSTRUMENT/DETECTOR" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxraylens/lens_material" ; rdfs:comment "Material used to make the lens." ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/TRANSMISSION_SPECTRUM/lambda" ; rdfs:comment """ Wavelength of the radiation. This array is of the same shape as ``T`` and ``Tdev``. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXstxm/ENTRY/INSTRUMENT/sample_x" ; rdfs:comment " Measurements of the sample position from the x-axis interferometer." ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/DATA/Idev" ; rdfs:comment """ .. index:: NXcanSAS (applications); Idev Estimated **uncertainty** (usually standard deviation) in :math:`I`. Must have the same units as :math:`I`. When present, the name of this field is also recorded in the *uncertainties* attribute of *I*, as in:: I/@uncertainties=\"Idev\" """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXgrating/deflection_angle" ; rdfs:comment "Angle between the incident beam and the utilised outgoing beam." ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/TRANSMISSION_SPECTRUM/signal" ; rdfs:comment """ Name of the default data field. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXsas/ENTRY/INSTRUMENT/COLLIMATOR/GEOMETRY/SHAPE/size" ; rdfs:comment "The collimation length." ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXreflections/observed_x_errors" ; rdfs:comment """ The standard deviation of the estimate of the x position at which the central impact of the reflection was recorded """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXentry/definition_local/URL" ; rdfs:comment "URL of NXDL file" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXattenuator/absorption_cross_section" ; rdfs:comment "Absorption cross section" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/int_prf_errors" ; rdfs:comment """ The standard deviation of the estimate of the reflection intensity by profile fitting """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsqom/ENTRY/DATA" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmirror/substrate_roughness" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXscan/ENTRY/SAMPLE" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmirror/OFF_GEOMETRY" ; rdfs:comment """ This group describes the shape of the beam line component """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXsource/bunch_length" ; rdfs:comment "For storage rings, temporal length of the bunch" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsample/chemical_formula" ; rdfs:comment """ \t\t\tThe chemical formula specified using CIF conventions. \t\t\tAbbreviated version of CIF standard: \t\t\t \t\t\t* Only recognized element symbols may be used. \t\t\t* Each element symbol is followed by a 'count' number. A count of '1' may be omitted. \t\t\t* A space or parenthesis must separate each cluster of (element symbol + count). \t\t\t* Where a group of elements is enclosed in parentheses, the multiplier for the \t\t\t group must follow the closing parentheses. That is, all element and group \t\t\t multipliers are assumed to be printed as subscripted numbers. \t\t\t* Unless the elements are ordered in a manner that corresponds to their chemical \t\t\t structure, the order of the elements within any group or moiety depends on \t\t\t whether or not carbon is present. \t\t\t* If carbon is present, the order should be: \t\t\t \t\t\t - C, then H, then the other elements in alphabetical order of their symbol. \t\t\t - If carbon is not present, the elements are listed purely in alphabetic order of their symbol. \t\t\t \t\t\t* This is the *Hill* system used by Chemical Abstracts. \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXbeam/TRANSFORMATIONS/DIRECTION/vector" ; rdfs:comment """ Three values that define the direction of beam vector """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXtomoproc/entry/reconstruction/date" ; rdfs:comment "Date and time of reconstruction processing." ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXtomophase/entry/control" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmonopd/entry/MONITOR/integral" ; rdfs:comment "Total integral monitor counts" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtofnpd/entry/MONITOR" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/predicted_x" ; rdfs:comment """ The x position at which the bragg peak of the reflection is predicted """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsas/ENTRY" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXtas/entry/SAMPLE/qk" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcollimator/divergence_x" ; rdfs:comment "divergence of collimator in local x direction" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXentry/title" ; rdfs:comment "Extended title for entry" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtomo/entry/instrument/SOURCE/name" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtofsingle/entry/SAMPLE" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/BEAM/total_flux_integrated" ; rdfs:comment """ Flux incident on beam plane in photons. In other words this is the :ref:`flux ` integrated over time and area. Useful where temporal beam profiles of flux are not known. In the case of a beam that varies in total flux shot-to-shot, this is an array of values, one for each recorded shot. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdetector_channel" ; rdfs:comment """ Description and metadata for a single channel from a multi-channel detector. Given an :ref:`NXdata` group linked as part of an NXdetector group that has an axis with named channels (see the example in :ref:`NXdata `), the NXdetector will have a series of NXdetector_channel groups, one for each channel, named CHANNELNAME_channel. Example, given these axes in the NXdata group:: @axes = [\"image_id\", \"channel\", \".\", \".\"] And this list of channels in the NXdata group:: channel = [\"threshold_1\", \"threshold_2\", \"difference\"] The NXdetector group would have three NXdetector_channel groups:: detector:NXdetector ... threshold_1_channel:NXdetector_channel threshold_energy = float flatfield = float[i, j] pixel_mask = uint[i, j] flatfield_applied = bool pixel_mask_applied = bool threshold_2_channel:NXdetector_channel threshold_energy = float flatfield = float[i, j] pixel_mask = uint[i, j] flatfield_applied = bool pixel_mask_applied = bool difference_channel:NXdetector_channel threshold_energy = float[2] """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXentry/thumbnail/type" ; rdfs:comment "The mime type should be an ``image/*``" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtas/entry/INSTRUMENT/analyser/ef" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsas/ENTRY/INSTRUMENT/SOURCE/type" ; rdfs:comment "Type of radiation source." ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXenvironment/depends_on" ; rdfs:comment """ NeXus positions components by applying a set of translations and rotations to apply to the component starting from 0, 0, 0. The order of these operations is critical and forms what NeXus calls a dependency chain. The depends_on field defines the path to the top most operation of the dependency chain or the string \".\" if located in the origin. Usually these operations are stored in a NXtransformations group. But NeXus allows them to be stored anywhere. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXarchive/entry/sample/preparation_date" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdirecttof/entry/INSTRUMENT/fermi_chopper/energy" ; rdfs:comment "energy selected" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXgrating/angles" ; rdfs:comment "Blaze or trapezoidal angles, with the angle of the upstream facing edge listed first. Blazed gratings can be identified by the low value of the first-listed angle." ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsample/relative_molecular_mass" ; rdfs:comment "Relative Molecular Mass of sample" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXfilter/substrate_roughness" ; rdfs:comment "substrate roughness (RMS) of supermirror filter" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdisk_chopper/top_dead_center/start" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . nxdetector:angular_calibration a rdfs:Class ; rdfs:label "NXdetector/angular_calibration" ; rdfs:comment "Angular calibration data." ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXspe/ENTRY/NXSPE_info" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsample/magnetic_field" ; rdfs:comment "magnetic_field.value is a link to e.g. magnetic_field_env.sensor1.value" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXfilter/coating_roughness" ; rdfs:comment "coating roughness (RMS) of supermirror filter" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxraylens/curvature" ; rdfs:comment "Radius of the curvature as measured in the middle of the lens" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXbending_magnet/source_distance_y" ; rdfs:comment """ Distance of source point from particle beam waist in Y (vertical) direction. Note, it is recommended to use NXtransformations instead to place component. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/det_module/description" ; rdfs:comment "Describes the dataset " ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXbeam/incident_polarization" ; rdfs:comment "Polarization vector on entering beamline component" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreftof/entry" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXarpes/ENTRY/INSTRUMENT/analyser/lens_mode" ; rdfs:comment "setting for the electron analyser lens" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsample_component/unit_cell_volume" ; rdfs:comment "Volume of the unit cell" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXarchive/entry" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXcrystal/temperature_log" ; rdfs:comment "log file of crystal temperature" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXtas/entry/INSTRUMENT/analyser" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXentry/entry_identifier_uuid/version" ; rdfs:comment "Version of UUID used" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsas/ENTRY/INSTRUMENT/SOURCE/name" ; rdfs:comment "Name of the radiation source." ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXarpes/ENTRY/INSTRUMENT/monochromator/energy" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXscan/ENTRY/MONITOR/data" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsample_component/unit_cell_abc" ; rdfs:comment "Crystallography unit cell parameters a, b, and c" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtas/entry/INSTRUMENT/DETECTOR/polar_angle" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/DETECTOR/countrate_correction_applied" ; rdfs:comment """ Counting detectors usually are not able to measure all incoming particles, especially at higher count-rates. Count-rate correction is applied to account for these errors. True when count-rate correction has been applied, false otherwise. """ ; rdfs:seeAlso ; rdfs:subClassOf nxdetector:countrate_correction_applied , . a rdfs:Class ; rdfs:label "NXdetector/y_pixel_offset/long_name" ; rdfs:comment "y-axis offset from detector center" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXfluo/entry/INSTRUMENT/SOURCE/probe" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/INSTRUMENT/COLLIMATOR" ; rdfs:comment """ Description of a collimating element (defines the divergence of the beam) in the instrument. To document a slit, pinhole, or the beam, refer to the documentation of the ``NXinstrument`` group above. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXdisk_chopper/type" ; rdfs:comment "Type of the disk-chopper: only one from the enumerated list (match text exactly)" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdisk_chopper/GEOMETRY" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXattenuator/scattering_cross_section" ; rdfs:comment "Scattering cross section (coherent+incoherent)" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXentry/entry_identifier" ; rdfs:comment "unique identifier for the measurement, defined by the facility." ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdata/y" ; rdfs:comment """ \t\t\tThis is an array holding the values to use for the y-axis of \t\t\tdata. The units must be appropriate for the measurement. \t\t\tThis is a special case of a :ref:`AXISNAME field ` \t\t\tkept for backward compatiblity. \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXinstrument/DISK_CHOPPER" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXpolarizer/efficiency" ; rdfs:comment "polarizing efficiency" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsubentry/IDF_Version" ; rdfs:comment "ISIS Muon IDF_Version" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsource/name" ; rdfs:comment "Name of source" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/definition" ; rdfs:comment "Official NeXus NXDL schema to which this subentry conforms." ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXcrystal/unit_cell_volume" ; rdfs:comment "Volume of the unit cell" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsensor/external_field_brief" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdetector_module/slow_pixel_direction/transformation_type" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtomophase/entry/instrument/bright_field" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/DATA/ShadowFactor" ; rdfs:comment """ A numerical factor applied to pixels affected by the beam stop penumbra. Used in data files from NIST/NCNR instruments. See: J.G. Barker and J.S. Pedersen (1995) *J. Appl. Cryst.* **28**, 105-114. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/PROCESS/term" ; rdfs:comment """ Specifies the value of a single variable, parameter, or term (while defined here as a string, it could be a number) related to the *SASprocess* step. Note: The name *term* is not required, it could take any name, as long as the name is unique within this group. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtofraw/entry/instrument/detector/polar_angle" ; rdfs:comment "polar angle for each detector element" ; rdfs:seeAlso ; rdfs:subClassOf nxdetector:polar_angle , . a rdfs:Class ; rdfs:label "NXtofsingle/entry/INSTRUMENT" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/DETECTOR/beam_center_y" ; rdfs:comment """ This is the y position where the direct beam would hit the detector. This is a length and can be outside of the actual detector. The length can be in physical units or pixels as documented by the units attribute. Normally, this should be derived from the axis chain, but the direct specification may take precedence if it is not a derived quantity. """ ; rdfs:seeAlso ; rdfs:subClassOf nxdetector:beam_center_y , . a rdfs:Class ; rdfs:label "NXxasproc/ENTRY/SAMPLE/name" ; rdfs:comment "Descriptive name of sample" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXmx/ENTRY/start_time" ; rdfs:comment """ ISO 8601 time/date of the first data point collected in UTC, using the Z suffix to avoid confusion with local time. Note that the time zone of the beamline should be provided in NXentry/NXinstrument/time_zone. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXxas/ENTRY/MONITOR/mode" ; rdfs:comment """ Count to a preset value based on either clock time (timer) or received monitor counts (monitor). """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXaperture/BLADE_GEOMETRY" ; rdfs:comment "location and shape of each blade" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXbeam_stop/TRANSFORMATIONS" ; rdfs:comment """ This is the group recommended for holding the chain of translation and rotation operations necessary to position the component within the instrument. The dependency chain may however traverse similar groups in other component groups. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXprocess/program" ; rdfs:comment "Name of the program used" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NX_TRANSFORMATION" ; rdfs:comment """ \t\t\t\tunits of the specified transformation \t\t\t\t \t\t\t\tcould be any of these: ``NX_LENGTH``, ``NX_ANGLE``, or ``NX_UNITLESS`` \t\t\t\t \t\t\t\tThere will be one or more transformations defined by one or more fields \t\t\t\tfor each transformation. The units type ``NX_TRANSFORMATION`` designates the \t\t\t\tparticular axis generating a transformation (e.g. a rotation axis or a translation \t\t\t\taxis or a general axis). ``NX_TRANSFORMATION`` designates the \t\t\t\tunits will be appropriate to the type of transformation, \t\t\t\tindicated in the :ref:`NXtransformations` base class \t\t\t\tby the ``transformation_type`` value: \t\t\t\t \t\t\t\t* ``NX_LENGTH`` for ``translation`` \t\t\t\t* ``NX_ANGLE`` for ``rotation`` \t\t\t\t* ``NX_UNITLESS`` for axes for which no transformation type is specified. \t\t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXfluo/entry/start_time" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxbase" ; rdfs:comment """ This definition covers the common parts of all monochromatic single crystal raw data application definitions. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXaperture/GEOMETRY" ; rdfs:comment """ location and shape of aperture .. TODO: documentation needs improvement, contributions welcome * description of terms is poor and leaves much to interpretation * Describe what is meant by translation _here_ and ... * Similar throughout base classes * Some base classes do this much better * Such as where is the gap written? """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXarchive/entry/sample/situation" ; rdfs:comment """ \t Description of the environment the sample is in: \t air, vacuum, oxidizing atmosphere, dehydrated, etc. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXxbase/entry/title" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsubentry/DATA" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXlog/cue_timestamp_zero/start" ; rdfs:comment "If missing start is assumed to be the same as for \"time\"." ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXgrating/layer_thickness" ; rdfs:comment " An array describing the thickness of each layer" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXfermi_chopper/transmitting_material" ; rdfs:comment "transmitting material" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdetector_module/slow_pixel_direction/offset_units" ; rdfs:comment """ \t\t\t\tUnits of the offset. \t\t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXlauetof/entry/sample" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXrefscan/entry/instrument/SOURCE/name" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcrystal/unit_cell_b" ; rdfs:comment "Unit cell lattice parameter: length of side b" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXbending_magnet/divergence_y_plus" ; rdfs:comment """ Accepted photon beam divergence in Y+ (vertical upward) direction. Note that divergence_y_plus+divergence_y_minus is the total vertical beam divergence. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXentry/program_name/version" ; rdfs:comment "Program version number" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXarchive/entry/sample/temperature" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXbeam/final_polarization" ; rdfs:comment "Polarization vector on leaving beamline component" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxas/ENTRY/INSTRUMENT/absorbed_beam/data" ; rdfs:comment "This data corresponds to the sample signal." ; rdfs:seeAlso ; rdfs:subClassOf nxdetector:data , . a rdfs:Class ; rdfs:label "NXtofsingle/entry/MONITOR/distance" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxasproc/ENTRY/DATA/energy" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsample/short_title" ; rdfs:comment "20 character fixed length sample description for legends" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsastof" ; rdfs:comment """ raw, 2-D SAS data with an area detector with a time-of-flight source It covers all raw data from any SAS techniques that use an area detector at a time-of-flight source. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmonochromator/CRYSTAL" ; rdfs:comment "Use as many crystals as necessary to describe" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXmirror/odd_layer_density" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXfluo/entry/data" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsample/concentration" ; rdfs:comment "Concentration of each component" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXslit/depends_on" ; rdfs:comment """ \t\t\tPoints to the path of the last element in the geometry chain that places \t\t\tthis object in space. \t\t\tWhen followed through that chain is supposed to end at an element depending \t\t\ton \".\" i.e. the origin of the coordinate system. \t\t\tIf desired the location of the slit can also be described relative to \t\t\tan NXbeam, which will allow a simple description of a non-centred slit. \t\t\tThe reference plane of the slit is orthogonal to the z axis and includes the \t\t\tsurface that is the entry surface of the slit. The reference point of the slit \t\t\tis the centre of the slit opening in the x and y axis on the reference plane. \t\t\tThe reference point on the z axis is the reference plane. \t\t\t.. image:: slit/slit.png \t\t\t\t:width: 40% \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtofraw/entry" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXtomoproc/entry/data/data/scaling" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxas/ENTRY/MONITOR/data" ; rdfs:comment "This field could be a link to ``/NXentry/NXinstrument/incoming_beam:NXdetector/data``" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXlog/average_value_errors" ; rdfs:comment "estimated uncertainty (often used: standard deviation) of average_value" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXaperture/NOTE" ; rdfs:comment "describe any additional information in a note" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXstxm/ENTRY/INSTRUMENT/DETECTOR/data" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsas/ENTRY/INSTRUMENT/DETECTOR/x_pixel_size" ; rdfs:comment "Physical size of a pixel in x-direction." ; rdfs:seeAlso ; rdfs:subClassOf nxdetector:x_pixel_size , . a rdfs:Class ; rdfs:label "NXtas/entry/INSTRUMENT/SOURCE/name" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXroot/creator_version" ; rdfs:comment "Version of facility or program used in writing the file" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXspe/ENTRY/NXSPE_info/ki_over_kf_scaling" ; rdfs:comment "Indicates whether ki/kf scaling has been applied or not." ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsample/magnetic_field" ; rdfs:comment "Applied magnetic field" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/DETECTOR/DETECTOR_MODULE/module_offset/depends_on" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsas/ENTRY/INSTRUMENT/DETECTOR/beam_center_x" ; rdfs:comment """ This is the x position where the direct beam would hit the detector. This is a length, not a pixel position, and can be outside of the actual detector. It is expected that data reduction will determine beam center from the raw data, thus it is not required here. The instrument can provide an initial or nominal value to advise data reduction. """ ; rdfs:seeAlso ; rdfs:subClassOf nxdetector:beam_center_x , . a rdfs:Class ; rdfs:label "NXstxm/ENTRY/SAMPLE/rotation_angle" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXxrot/entry/instrument/detector/beam_center_x" ; rdfs:comment """ This is the x position where the direct beam would hit the detector. This is a length, not a pixel position, and can be outside of the actual detector. """ ; rdfs:seeAlso ; rdfs:subClassOf nxdetector:beam_center_x , . a rdfs:Class ; rdfs:label "NXvelocity_selector/OFF_GEOMETRY" ; rdfs:comment """ This group describes the shape of the beam line component """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/DETECTOR/frame_time" ; rdfs:comment """ This is time for each frame. This is exposure_time + readout time. """ ; rdfs:seeAlso ; rdfs:subClassOf nxdetector:frame_time , . a rdfs:Class ; rdfs:label "NXiqproc/ENTRY/reduction/program" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmonochromator" ; rdfs:comment """ A wavelength defining device. This is a base class for everything which selects a wavelength or energy, be it a monochromator crystal, a velocity selector, an undulator or whatever. The expected units are: * wavelength: angstrom * energy: eV """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcrystal/thickness" ; rdfs:comment "Thickness of the crystal. (Required for Laue orientations - see \"usage\" field)" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsample/external_ADC" ; rdfs:comment "logged value (or logic state) read from user's setup" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXdetector/x_pixel_offset/axis" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXrefscan/entry/instrument/monochromator" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:comment "NeXus Base Class (Newer entries are found in Contributed Definitions)" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXbending_magnet/critical_energy" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsample/depends_on" ; rdfs:comment """ NeXus positions components by applying a set of translations and rotations to apply to the component starting from 0, 0, 0. The order of these operations is critical and forms what NeXus calls a dependency chain. The depends_on field defines the path to the top most operation of the dependency chain or the string \".\" if located in the origin. Usually these operations are stored in a NXtransformations group. But NeXus allows them to be stored anywhere. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtranslation/default" ; rdfs:comment """ .. index:: plotting Declares which child group contains a path leading to a :ref:`NXdata` group. It is recommended (as of NIAC2014) to use this attribute to help define the path to the default dataset to be plotted. See https://www.nexusformat.org/2014_How_to_find_default_data.html for a summary of the discussion. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsqom/ENTRY/DATA/qx" ; rdfs:comment "Positions for the first dimension of Q" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsample/electric_field/direction" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NX_FREQUENCY" ; rdfs:comment """ \t\t\t\tunits of frequency \t\t\t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxeuler/entry/sample/rotation_angle" ; rdfs:comment """ This is an array holding the sample rotation angle at each scan point """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXfermi_chopper/height" ; rdfs:comment "input beam height" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXspe/ENTRY/data/distance" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcrystal/reflection" ; rdfs:comment "Miller indices (hkl) values of nominal reflection" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXevent_data" ; rdfs:comment """ NXevent_data is a special group for storing data from neutron detectors in event mode. In this mode, the detector electronics emits a stream of detectorID, timestamp pairs. With detectorID describing the detector element in which the neutron was detected and timestamp the timestamp at which the neutron event was detected. In NeXus detectorID maps to event_id, event_time_offset to the timestamp. As this kind of data is common at pulsed neutron sources, the timestamp is almost always relative to the start of a neutron pulse. Thus the pulse timestamp is recorded too together with an index in the event_id, event_time_offset pair at which data for that pulse starts. At reactor source the same pulsed data effect may be achieved through the use of choppers or in stroboscopic measurement setups. In order to make random access to timestamped data faster there is an optional array pair of cue_timestamp_zero and cue_index. The cue_timestamp_zero will contain courser timestamps then in the time array, say every five minutes. The cue_index will then contain the index into the event_id,event_time_offset pair of arrays for that courser cue_timestamp_zero. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxbase/entry" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXinsertion_device/bandwidth" ; rdfs:comment "bandwidth of peak energy" ; rdfs:seeAlso ; rdfs:subClassOf . nxdetector:pixel_mask_applied a rdfs:Class ; rdfs:label "NXdetector/pixel_mask_applied" ; rdfs:comment """ True when the pixel mask correction has been applied in the electronics, false otherwise. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsample/space_group" ; rdfs:comment "Crystallographic space group" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXinstrument/MODERATOR" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxlaueplate/entry" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsqom/ENTRY/instrument/SOURCE" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtranslation/geometry" ; rdfs:comment "Link to other object if we are relative, else absent" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXreflections/azimuthal_angle" ; rdfs:comment """ Azimuthal angle of reflection centroid, following the NeXus simple (spherical polar) coordinate system """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXvelocity_selector/type" ; rdfs:comment "velocity selector type" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXentry/end_time" ; rdfs:comment "Ending time of measurement" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcite/url" ; rdfs:comment "URL referencing the document or data." ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXrefscan/entry/control/data" ; rdfs:comment "Monitor counts for each step" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtomophase/entry/instrument/dark_field/data" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxraylens/TRANSFORMATIONS" ; rdfs:comment """ This is the group recommended for holding the chain of translation and rotation operations necessary to position the component within the instrument. The dependency chain may however traverse similar groups in other component groups. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXtomo/entry/instrument/detector/y_rotation_axis_pixel_position" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/INSTRUMENT/DETECTOR/slit_length" ; rdfs:comment """ Slit length of the instrument for this detector, expressed in the same units as :math:`Q`. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXgrating/depends_on" ; rdfs:comment """ NeXus positions components by applying a set of translations and rotations to apply to the component starting from 0, 0, 0. The order of these operations is critical and forms what NeXus calls a dependency chain. The depends_on field defines the path to the top most operation of the dependency chain or the string \".\" if located in the origin. Usually these operations are stored in a NXtransformations group. But NeXus allows them to be stored anywhere. .. todo:: Add a definition for the reference point of a bending grating. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsample/description" ; rdfs:comment """ \t\t\tDescription of the sample \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/DETECTOR_GROUP/group_names" ; rdfs:comment """ An array of the names of the detectors or the names of hierarchical groupings of detectors. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXvelocity_selector/width" ; rdfs:comment "input beam width" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtofraw/entry/user" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmonopd/entry/INSTRUMENT/SOURCE/name" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcylindrical_geometry/default" ; rdfs:comment """ .. index:: plotting Declares which child group contains a path leading to a :ref:`NXdata` group. It is recommended (as of NIAC2014) to use this attribute to help define the path to the default dataset to be plotted. See https://www.nexusformat.org/2014_How_to_find_default_data.html for a summary of the discussion. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsample/pressure" ; rdfs:comment "Applied pressure" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/title" ; rdfs:comment """ Title of this *SASentry*. Make it so that you can recognize the data by its title. Could be the name of the sample, the name for the measured data, or something else representative. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXdetector_module/fast_pixel_direction" ; rdfs:comment """ Values along the direction of :ref:`fastest varying ` :index:`pixel direction`. Each value in this array is the size of a pixel in the units specified. Alternatively, if only one value is given, all pixels in this direction have the same value. The direction itself is given through the vector attribute. \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsample/name" ; rdfs:comment "Descriptive name of sample" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/INSTRUMENT/DETECTOR/canSAS_class" ; rdfs:comment "Official canSAS group: :index:`NXcanSAS (applications); SASdetector`" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/TRANSMISSION_SPECTRUM/T/uncertainties" ; rdfs:comment """ Names the dataset (in this SASdata group) that provides the uncertainty of each transmission :math:`T` to be used for data analysis. The name of the dataset containing the :math:`T` uncertainty is expected to be ``Tdev``. .. comment see: https://github.com/canSAS-org/canSAS2012/issues/7 Typically: @uncertainties=\"Tdev\" """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxrot/entry/sample" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsubentry/entry_identifier" ; rdfs:comment "unique identifier for the measurement, defined by the facility." ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmonochromator/energy_error" ; rdfs:comment "energy standard deviation" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXstxm/ENTRY/definition" ; rdfs:comment " Official NeXus NXDL schema to which this file conforms " ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXarpes/ENTRY/INSTRUMENT/analyser/time_per_channel" ; rdfs:comment "todo: define more clearly" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXguide/reflectivity/axes" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXarchive/entry/end_time" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmirror/shape" ; rdfs:comment "A NXshape group describing the shape of the mirror" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/BEAM/incident_polarisation_stokes" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXpositioner/soft_limit_min" ; rdfs:comment "minimum allowed limit to set value" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsample_component/transmission" ; rdfs:comment "As a function of Wavelength" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXxbase/entry/instrument/source/probe" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXenvironment/program" ; rdfs:comment "Program controlling the apparatus; e.g. LabView VI name" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreftof/entry/sample/rotation_angle" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/DETECTOR/DETECTOR_MODULE/slow_pixel_direction/offset" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmonochromator/depends_on" ; rdfs:comment """ NeXus positions components by applying a set of translations and rotations to apply to the component starting from 0, 0, 0. The order of these operations is critical and forms what NeXus calls a dependency chain. The depends_on field defines the path to the top most operation of the dependency chain or the string \".\" if located in the origin. Usually these operations are stored in a NXtransformations group. But NeXus allows them to be stored anywhere. .. todo:: Add a definition for the reference point of a monochromator. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmonitor/TRANSFORMATIONS" ; rdfs:comment """ This is the group recommended for holding the chain of translation and rotation operations necessary to position the component within the instrument. The dependency chain may however traverse similar groups in other component groups. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXxas/ENTRY/INSTRUMENT/monochromator/energy" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXrefscan/entry/control/preset" ; rdfs:comment "preset value for time or monitor" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXfluo/entry/SAMPLE" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXattenuator/attenuator_transmission" ; rdfs:comment """ The nominal amount of the beam that gets through (transmitted intensity)/(incident intensity) """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXiqproc/ENTRY/instrument/SOURCE/probe" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXxbase/entry/sample/unit_cell" ; rdfs:comment """ The unit cell, a, b, c, alpha, beta, gamma. Again, not strictly necessary, but normally written. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXtofsingle/entry/user" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/BEAM/flux" ; rdfs:comment """ Flux density incident on beam plane area in photons per second per unit area. In the case of a beam that varies in flux shot-to-shot, this is an array of values, one for each recorded shot. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtofnpd/entry/INSTRUMENT/detector/azimuthal_angle" ; rdfs:comment "azimuthal angle for each detector element" ; rdfs:seeAlso ; rdfs:subClassOf nxdetector:azimuthal_angle , . a rdfs:Class ; rdfs:label "NXreflections/observed_y_var/description" ; rdfs:comment "Describes the dataset " ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXinstrument/SOURCE" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXgrating/substrate_density" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXarpes/ENTRY/INSTRUMENT/analyser/sensor_size" ; rdfs:comment "number of raw active elements in each dimension" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/BEAM/flux_integrated" ; rdfs:comment """ Flux density incident on beam plane area in photons per unit area. In other words this is the :ref:`flux ` integrated over time. Useful where temporal beam profiles of flux are not known. In the case of a beam that varies in flux shot-to-shot, this is an array of values, one for each recorded shot. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXprocess/date" ; rdfs:comment "Date and time of processing." ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/int_sum_var" ; rdfs:comment """ The variance on the estimate of the reflection intensity by summation """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXbeam/TRANSFORMATIONS/DIRECTION/transformation_type" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXflipper/flip_turns" ; rdfs:comment "Linear density of turns (such as number of turns/cm) in flipping field coils" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXfermi_chopper/r_slit" ; rdfs:comment "radius of curvature of slits" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXbending_magnet/TRANSFORMATIONS" ; rdfs:comment """ This is the group recommended for holding the chain of translation and rotation operations necessary to position the component within the instrument. The dependency chain may however traverse similar groups in other component groups. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXreflections/observed_px_y_var/description" ; rdfs:comment "Describes the dataset " ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxas/ENTRY/entry" ; rdfs:comment """ NeXus convention is to use \"entry1\", \"entry2\", ... for analysis software to locate each entry. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtas/entry/MONITOR/preset" ; rdfs:comment "preset value for time or monitor" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXindirecttof/entry/INSTRUMENT/analyser/energy" ; rdfs:comment "analyzed energy " ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXsas/ENTRY/INSTRUMENT/COLLIMATOR/GEOMETRY/SHAPE" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXflipper/depends_on" ; rdfs:comment """ NeXus positions components by applying a set of translations and rotations to apply to the component starting from 0, 0, 0. The order of these operations is critical and forms what NeXus calls a dependency chain. The depends_on field defines the path to the top most operation of the dependency chain or the string \".\" if located in the origin. Usually these operations are stored in a NXtransformations group. But NeXus allows them to be stored anywhere. .. todo:: Add a definition for the reference point of a spin flipper. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdata/errors" ; rdfs:comment """ \t\t\tStandard deviations of data values - \t\t\tthe data array is identified by the group attribute ``signal``. \t\t\tThe ``errors`` array must have the same dimensions as ``DATA``. \t\t\tClient is responsible for defining the dimensions of the data. \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsastof/ENTRY/instrument/detector/beam_center_x" ; rdfs:comment """ \t This is the x position where the direct beam would hit the detector. This is a \t length, not a pixel position, and can be outside of the actual detector. """ ; rdfs:seeAlso ; rdfs:subClassOf nxdetector:beam_center_x , . a rdfs:Class ; rdfs:label "NX_AREA" ; rdfs:comment """ \t\t\t\tunits of area \t\t\t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmonitor/integral_log" ; rdfs:comment "Time variation of monitor counts" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXdata/AXISNAME/units" ; rdfs:comment """ \t\t\t\tUnit in which the coordinate values are expressed. \t\t\t\tSee the section :ref:`Design-Units` for more information. \t\t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsource/TRANSFORMATIONS" ; rdfs:comment """ This is the group recommended for holding the chain of translation and rotation operations necessary to position the component within the instrument. The dependency chain may however traverse similar groups in other component groups. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXguide/default" ; rdfs:comment """ .. index:: plotting Declares which child group contains a path leading to a :ref:`NXdata` group. It is recommended (as of NIAC2014) to use this attribute to help define the path to the default dataset to be plotted. See https://www.nexusformat.org/2014_How_to_find_default_data.html for a summary of the discussion. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtomoproc/entry/INSTRUMENT/SOURCE/probe" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXattenuator/depends_on" ; rdfs:comment """ NeXus positions components by applying a set of translations and rotations to apply to the component starting from 0, 0, 0. The order of these operations is critical and forms what NeXus calls a dependency chain. The depends_on field defines the path to the top most operation of the dependency chain or the string \".\" if located in the origin. Usually these operations are stored in a NXtransformations group. But NeXus allows them to be stored anywhere. The reference point of the attenuator is its center in the x and y axis. The reference point on the z axis is the surface of the attenuator pointing towards the source. In complex (asymmetic) geometries an NXoff_geometry group can be used to provide an unambiguous reference. .. image:: attenuator/attenuator.png :width: 40% """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/predicted_px_x" ; rdfs:comment """ The x pixel position at which the bragg peak of the reflection is predicted """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtofsingle/entry/pre_sample_flightpath" ; rdfs:comment """ This is the flight path before the sample position. This can be determined by a chopper, by the moderator or the source itself. In other words: it the distance to the component which gives the T0 signal to the detector electronics. If another component in the NXinstrument hierarchy provides this information, this should be a link. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXfermi_chopper/OFF_GEOMETRY" ; rdfs:comment """ This group describes the shape of the beam line component """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXarpes/ENTRY/INSTRUMENT/SOURCE/type" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXreflections/observed_frame" ; rdfs:comment """ The estimate of the frame at which the central impact of the reflection was recorded """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdirecttof/entry/INSTRUMENT" ; rdfs:comment """ We definitly want the rotation_speed and energy of the chopper. Thus either a fermi_chopper or a disk_chopper group is required. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXdisk_chopper/OFF_GEOMETRY" ; rdfs:comment """ This group describes the shape of the beam line component """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXpositioner/acceleration_time" ; rdfs:comment "time to ramp the velocity up to full speed" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdirecttof/entry" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:comment "NeXus Application Class (Newer entries are found in Contributed Definitions)" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXvelocity_selector/rotation_speed" ; rdfs:comment "velocity selector rotation speed" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/predicted_phi" ; rdfs:comment """ The phi angle at which the bragg peak of the reflection is predicted """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXstxm/ENTRY/INSTRUMENT/SOURCE/name" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtofraw/entry/data" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxlaueplate" ; rdfs:comment """ raw data from a single crystal Laue camera, extends :ref:`NXxlaue` This is the application definition for raw data from a single crystal Laue camera with an image plate as a detector. It extends :ref:`NXxlaue`. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsample/temperature_env" ; rdfs:comment "Additional sample temperature environment information" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXarchive/entry/instrument/description" ; rdfs:comment "Brief description of the instrument" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXscan/ENTRY/definition" ; rdfs:comment " Official NeXus NXDL schema to which this file conforms " ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXsample/POSITIONER" ; rdfs:comment "Any positioner (motor, PZT, ...) used to locate the sample" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/DETECTOR/COLLECTION" ; rdfs:comment """ Suggested container for detailed non-standard detector information like corrections applied automatically or performance settings. """ ; rdfs:seeAlso ; rdfs:subClassOf , . nxdetector:crate a rdfs:Class ; rdfs:label "NXdetector/crate" ; rdfs:comment "Crate number of detector" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXfilter/coating_material" ; rdfs:comment "coating material of supermirror filter" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/predicted_px_y/description" ; rdfs:comment "Describes the dataset " ; rdfs:seeAlso ; rdfs:subClassOf . nxdetector:detector_number a rdfs:Class ; rdfs:label "NXdetector/detector_number" ; rdfs:comment """ \tIdentifier for detector (pixels) \tCan be multidimensional, if needed """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/DATA/Q/units" ; rdfs:comment """ Engineering units to use when expressing :math:`Q` and related terms. Data expressed in other units will generate a warning from validation software and may not be processed by some analysis software packages. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtas/entry/SAMPLE/ql" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsastof/ENTRY/instrument/collimator/geometry/shape" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . nxdetector:depends_on a rdfs:Class ; rdfs:label "NXdetector/depends_on" ; rdfs:comment """ NeXus positions components by applying a set of translations and rotations to apply to the component starting from 0, 0, 0. The order of these operations is critical and forms what NeXus calls a dependency chain. The depends_on field defines the path to the top most operation of the dependency chain or the string \".\" if located in the origin. Usually these operations are stored in a NXtransformations group. But NeXus allows them to be stored anywhere. The reference point of the detector is the center of the first pixel. In complex geometries the NXoff_geometry groups can be used to provide an unambiguous reference. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsastof/ENTRY/control/preset" ; rdfs:comment "preset value for time or monitor" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsample/sample_orientation" ; rdfs:comment """ \t\t\tThis will follow the Busing-Levy convention: \t\t\tW. R. Busing and H. A. Levy (1967). Acta Cryst. 22, 457-464 \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsample/SAMPLE_COMPONENT" ; rdfs:comment """ \t\t\tOne group per sample component \t\t\tThis is the perferred way of recording per component information over the n_comp arrays \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXsource/name/short_name" ; rdfs:comment "short name for source, perhaps the acronym" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsource/emittance_x" ; rdfs:comment "Source emittance (nm-rad) in X (horizontal) direction." ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsample/transmission" ; rdfs:comment "As a function of Wavelength" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXspe/ENTRY/INSTRUMENT/FERMI_CHOPPER" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXspe/ENTRY/program_name" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . nxdetector:gas_pressure a rdfs:Class ; rdfs:label "NXdetector/gas_pressure" ; rdfs:comment "Detector gas pressure" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmirror/substrate_material" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXattenuator/distance" ; rdfs:comment "Distance from sample. Note, it is recommended to use NXtransformations instead." ; rdfs:seeAlso ; rdfs:subClassOf . nxdetector:beam_center_y a rdfs:Class ; rdfs:label "NXdetector/beam_center_y" ; rdfs:comment """ This is the y position where the direct beam would hit the detector. This is a length and can be outside of the actual detector. The length can be in physical units or pixels as documented by the units attribute. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtranslation/distances" ; rdfs:comment """ \t\t\t(x,y,z) \t\t\tThis field describes the lateral movement of a component. \t\t\tThe pair of groups NXtranslation and NXorientation together \t\t\tdescribe the position of a component. \t\t\tFor absolute position, the origin is the scattering center (where a perfectly \t\t\taligned sample would be) with the z-axis pointing downstream and the y-axis \t\t\tpointing gravitationally up. For a relative position the NXtranslation is \t\t\ttaken into account before the NXorientation. The axes are right-handed and \t\t\torthonormal. \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NX_BINARY" ; rdfs:comment "any representation of binary data - if text, line terminator is [CR][LF]" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/TRANSMISSION_SPECTRUM" ; rdfs:comment """ The *SAStransmission_spectrum* element This describes certain data obtained from a variable-wavelength source such as pulsed-neutron source. The name of each *SAStransmission_spectrum* group must be unique within a SASentry group. Suggest using names such as ``sastransmission_spectrum01``. """ ; rdfs:seeAlso ; rdfs:subClassOf , . nxdetector:flatfield_errors a rdfs:Class ; rdfs:label "NXdetector/flatfield_errors" ; rdfs:comment """ Errors of the flat field correction data. The form flatfield_error is deprecated. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmirror/depends_on" ; rdfs:comment """ NeXus positions components by applying a set of translations and rotations to apply to the component starting from 0, 0, 0. The order of these operations is critical and forms what NeXus calls a dependency chain. The depends_on field defines the path to the top most operation of the dependency chain or the string \".\" if located in the origin. Usually these operations are stored in a NXtransformations group. But NeXus allows them to be stored anywhere. Given a flat mirror, the reference plane is the plane which contains the \"entry\" surface of the mirror. The reference point of the mirror in the x and y axis is the centre of the mirror on that plane. The reference plane is orthogonal to the z axis and the location of this plane is the reference point on the z axis. The mirror faces negative z values. .. image:: mirror/mirror.png :width: 40% """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsource/pulse_shape" ; rdfs:comment "source pulse shape" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXattenuator/shape" ; rdfs:comment """ Shape of this component. Particulary useful to define the origin for position and orientation in non-standard cases. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXtomophase/entry/sample/name" ; rdfs:comment "Descriptive name of sample" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXgrating/figure_data" ; rdfs:comment "Numerical description of the surface figure of the mirror." ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXtomo/entry/instrument" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXsqom/ENTRY/SAMPLE/name" ; rdfs:comment "Descriptive name of sample" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXcapillary/transmission" ; rdfs:comment """ The transmission of the capillary as a function of energy """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXxraylens/aperture" ; rdfs:comment "Diameter of the lens." ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtomo/entry/sample/y_translation" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtofraw/entry/instrument/detector" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcrystal/unit_cell_beta" ; rdfs:comment "Unit cell lattice parameter: angle beta" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXarpes/ENTRY/INSTRUMENT" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXbeam" ; rdfs:comment """ Properties of the neutron or X-ray beam at a given location. This group is intended to be referenced by beamline component groups within the :ref:`NXinstrument` group or by the :ref:`NXsample` group. This group is especially valuable in storing the results of instrument simulations in which it is useful to specify the beam profile, time distribution etc. at each beamline component. Otherwise, its most likely use is in the :ref:`NXsample` group in which it defines the results of the neutron scattering by the sample, e.g., energy transfer, polarizations. Finally, There are cases where the beam is considered as a beamline component and this group may be defined as a subgroup directly inside :ref:`NXinstrument`, in which case it is recommended that the position of the beam is specified by an :ref:`NXtransformations` group, unless the beam is at the origin (which is the sample). Note that incident_wavelength and related fields can be a scalar values or arrays, depending on the use case. To support these use cases, the explicit dimensionality of these fields is not specified, but it can be inferred by the presense of and shape of accompanying fields, such as incident_wavelength_weights for a polychromatic beam. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXnote/data" ; rdfs:comment "Binary note data - if text, line terminator is [CR][LF]." ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXiqproc/ENTRY/instrument/SOURCE/type" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXsas/ENTRY/DATA" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/BEAM/total_flux" ; rdfs:comment """ Flux incident on beam plane in photons per second. In other words this is the :ref:`flux ` integrated over area. Useful where spatial beam profiles are not known. In the case of a beam that varies in total flux shot-to-shot, this is an array of values, one for each recorded shot. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmonitor/mode" ; rdfs:comment """ Count to a preset value based on either clock time (timer) or received monitor counts (monitor). """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsample/volume_fraction" ; rdfs:comment "Volume fraction of each component" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtransformations/AXISNAME/offset_units" ; rdfs:comment """ \t\t\t\tUnits of the offset. Values should be consistent with NX_LENGTH. \t\t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXspe/ENTRY/NXSPE_info/psi" ; rdfs:comment "Orientation angle as expected in DCS-MSlice" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxlaue/entry/instrument" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXmirror/description" ; rdfs:comment "description of this mirror" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/PROCESS/COLLECTION/canSAS_class" ; rdfs:comment """ Official canSAS group: :index:`NXcanSAS (applications); SASprocessnote` """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsas/ENTRY/INSTRUMENT/COLLIMATOR/GEOMETRY" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXxlaue/entry/instrument/source/distribution" ; rdfs:comment """ This is the wavelength distribution of the beam """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXreftof/entry/instrument/detector/time_of_flight" ; rdfs:comment """ Array of time values for each bin in a time-of-flight measurement """ ; rdfs:seeAlso ; rdfs:subClassOf nxdetector:time_of_flight , . a rdfs:Class ; rdfs:label "NXroot/creator" ; rdfs:comment "facility or program where file originated" ; rdfs:seeAlso ; rdfs:subClassOf . nxdetector:trigger_internal_delay_time a rdfs:Class ; rdfs:label "NXdetector/trigger_internal_delay_time" ; rdfs:comment """ Time it takes to start exposure after a trigger signal has been received. This is the reaction time of the detector hardware after receiving the trigger signal to when the detector starts to acquire the exposure. It forms the lower boundary of the trigger_delay_time when the user does not request an additional delay. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/DETECTOR/DETECTOR_MODULE/data_size" ; rdfs:comment """ Two or three values for the size of the module in pixels in each direction. Dimensionality and order of indices is the same as for data_origin. """ ; rdfs:seeAlso ; rdfs:subClassOf , . nxdetector:sensor_material a rdfs:Class ; rdfs:label "NXdetector/sensor_material" ; rdfs:comment """ At times, radiation is not directly sensed by the detector. Rather, the detector might sense the output from some converter like a scintillator. This is the name of this converter material. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/SAMPLE/canSAS_class" ; rdfs:comment "Official canSAS group: :index:`NXcanSAS (applications); SASsample`" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/k/description" ; rdfs:comment "Describes the dataset " ; rdfs:seeAlso ; rdfs:subClassOf . nxdetector:virtual_pixel_interpolation_applied a rdfs:Class ; rdfs:label "NXdetector/virtual_pixel_interpolation_applied" ; rdfs:comment """ True when virtual pixel interpolation has been applied, false otherwise. When virtual pixel interpolation is applied, values of some pixels may contain interpolated values. For example, to account for space between readout chips on a module, physical pixels on edges and corners between chips may have larger sensor areas and counts may be distributed between their logical pixels. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXstxm/ENTRY/SAMPLE" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtas" ; rdfs:comment """ This is an application definition for a triple axis spectrometer. It is for the trademark scan of the TAS, the Q-E scan. For your alignment scans use the rules in :ref:`NXscan`. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/PROCESS/name" ; rdfs:comment "Optional name for this data processing or analysis step" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxraylens/gas" ; rdfs:comment "Gas used to fill the lens" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdata/AXISNAME_indices" ; rdfs:comment """ \t\t\tThe ``AXISNAME_indices`` attribute is a single integer or an array of integers that defines which :ref:`data ` \t\t\tdimension(s) are spanned by the corresponding axis. The first dimension index is ``0`` (zero). \t\t\tWhen the ``AXISNAME_indices`` attribute is missing for an :ref:`AXISNAME ` field, its value becomes the index \t\t\t(or indices) of the :ref:`AXISNAME ` name in the :ref:`axes ` attribute. \t\t\t.. note:: When ``AXISNAME_indices`` contains multiple integers, it must be saved as an actual array \t\t\t\tof integers and not a comma separated string. \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsample_component/relative_molecular_mass" ; rdfs:comment "Relative Molecular Mass of sample component" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXpinhole/diameter" ; rdfs:comment "Size of the circular hole defining the transmitted beam size." ; rdfs:seeAlso ; rdfs:subClassOf . nxdetector:sensor_thickness a rdfs:Class ; rdfs:label "NXdetector/sensor_thickness" ; rdfs:comment """ At times, radiation is not directly sensed by the detector. Rather, the detector might sense the output from some converter like a scintillator. This is the thickness of this converter material. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXnote/default" ; rdfs:comment """ .. index:: plotting Declares which child group contains a path leading to a :ref:`NXdata` group. It is recommended (as of NIAC2014) to use this attribute to help define the path to the default dataset to be plotted. See https://www.nexusformat.org/2014_How_to_find_default_data.html for a summary of the discussion. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/DATA/I" ; rdfs:comment """ .. index:: NXcanSAS (applications); I \t\t\t Array of intensity (:math:`I`) data. The intensity may be represented in one of these forms: **absolute units**: :math:`d\\Sigma/d\\Omega(Q)` differential cross-section per unit volume per unit solid angle (such as: 1/cm/sr or 1/m/sr) **absolute units**: :math:`d\\sigma/d\\Omega(Q)` differential cross-section per unit atom per unit solid angle (such as: cm^2 or m^2) **arbitrary units**: :math:`I(Q)` usually a ratio of two detectors but units are meaningless (such as: a.u. or counts) This presents a few problems for analysis software to sort out when reading the data. Fortunately, it is possible to analyze the *units* to determine which type of intensity is being reported and make choices at the time the file is read. But this is an area for consideration and possible improvement. One problem arises with software that automatically converts data into some canonical units used by that software. The software should not convert units between these different types of intensity indiscriminately. A second problem is that when arbitrary units are used, then the set of possible analytical results is restricted. With such units, no meaningful volume fraction or number density can be determined directly from :math:`I(Q)`. In some cases, it is possible to apply a factor to convert the arbitrary units to an absolute scale. This should be considered as a possibility of the analysis process. Where this documentation says *typical units*, it is possible that small-angle data may be presented in other units and still be consistent with NeXus. See the :ref:`design-units` section. \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXiqproc/ENTRY/SAMPLE" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/INSTRUMENT/COLLIMATOR/canSAS_class" ; rdfs:comment "Official canSAS group: :index:`NXcanSAS (applications); SAScollimation`" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/observed_y_var" ; rdfs:comment """ The variance on the estimate of the y position at which the central impact of the reflection was recorded """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcrystal/order_no" ; rdfs:comment """ A number which describes if this is the first, second,.. :math:`n^{th}` crystal in a multi crystal monochromator """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NX_SOLID_ANGLE" ; rdfs:comment """ \t\t\t\tunits of solid angle \t\t\t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmonopd/entry/MONITOR/mode" ; rdfs:comment """ Count to a preset value based on either clock time (timer) or received monitor counts (monitor). """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXtransformations/AXISNAME/vector" ; rdfs:comment """ \t\t\t\tThree values that define the axis for this transformation. \t\t\t\tThe axis should be normalized to unit length, making it \t\t\t\tdimensionless. For ``rotation`` axes, the direction should be \t\t\t\tchosen for a right-handed rotation with increasing angle. \t\t\t\tFor ``translation`` axes the direction should be chosen for \t\t\t\tincreasing displacement. For general axes, an appropriate direction \t\t\t\tshould be chosen. \t\t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/DETECTOR_GROUP" ; rdfs:comment """ Optional logical grouping of detectors. Each detector is represented as an NXdetector with its own detector data array. Each detector data array may be further decomposed into array sections by use of NXdetector_module groups. Detectors can be grouped logically together using NXdetector_group. Groups can be further grouped hierarchically in a single NXdetector_group (for example, if there are multiple detectors at an endstation or multiple endstations at a facility). Alternatively, multiple NXdetector_groups can be provided. The groups are defined hierarchically, with names given in the group_names field, unique identifying indices given in the field group_index, and the level in the hierarchy given in the group_parent field. For example if an x-ray detector group, DET, consists of four detectors in a rectangular array:: DTL\tDTR DLL\tDLR We could have:: group_names: [\"DET\", \"DTL\", \"DTR\", \"DLL\", \"DLR\"] group_index: [1, 2, 3, 4, 5] group_parent: [-1, 1, 1, 1, 1] """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXattenuator/thickness" ; rdfs:comment "Thickness of attenuator along beam direction" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdisk_chopper/radius" ; rdfs:comment "Radius of the disk" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXiqproc/ENTRY/DATA/qy" ; rdfs:comment "Values for the second dimension of Q" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtomophase/entry/instrument/sample" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXattenuator" ; rdfs:comment """ A device that reduces the intensity of a beam by attenuation. If uncertain whether to use :ref:`NXfilter` (band-pass filter) or :ref:`NXattenuator` (reduces beam intensity), then choose :ref:`NXattenuator`. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtofnpd/entry/data" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsubentry/program_name/version" ; rdfs:comment "Program version number" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtas/entry/MONITOR/mode" ; rdfs:comment """ Count to a preset value based on either clock time (timer) or received monitor counts (monitor). """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXaperture/depends_on" ; rdfs:comment """ NeXus positions components by applying a set of translations and rotations to apply to the component starting from 0, 0, 0. The order of these operations is critical and forms what NeXus calls a dependency chain. The depends_on field defines the path to the top most operation of the dependency chain or the string \".\" if located in the origin. Usually these operations are stored in a NXtransformations group. But NeXus allows them to be stored anywhere. The reference point of the aperture is its center in the x and y axis. The reference point on the z axis is the surface of the aperture pointing towards the source. In complex (asymmetic) geometries an NXoff_geometry group can be used to provide an unambiguous reference. .. image:: aperture/aperture.png :width: 40% """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXentry/definition" ; rdfs:comment """ \t\t\t(alternate use: see same field in :ref:`NXsubentry` for preferred) \t\t\t \t\t\tOfficial NeXus NXDL schema to which this entry conforms which must be \t\t\tthe name of the NXDL file (case sensitive without the file extension) \t\t\tthat the NXDL schema is defined in. \t\t\t \t\t\tFor example the ``definition`` field for a file that conformed to the \t\t\t*NXarpes.nxdl.xml* definition must contain the string **NXarpes**. \t\t\t \t\t\tThis field is provided so that :ref:`NXentry` can be the overlay position \t\t\tin a NeXus data file for an application definition and its \t\t\tset of groups, fields, and attributes. \t\t\t*It is advised* to use :ref:`NXsubentry`, instead, as the overlay position. \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXarpes/ENTRY/INSTRUMENT/analyser/entrance_slit_shape" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsample_component/name" ; rdfs:comment "Descriptive name of sample component" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/TRANSMISSION_SPECTRUM/canSAS_class" ; rdfs:comment "Official canSAS group: :index:`NXcanSAS (applications); SAStransmission_spectrum`" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/int_prf_var" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmirror/default" ; rdfs:comment """ .. index:: plotting Declares which child group contains a path leading to a :ref:`NXdata` group. It is recommended (as of NIAC2014) to use this attribute to help define the path to the default dataset to be plotted. See https://www.nexusformat.org/2014_How_to_find_default_data.html for a summary of the discussion. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdata/DATA/axes" ; rdfs:comment """ \t\t\t\tDefines the names of the coordinates \t\t\t\t(independent axes) for this data set \t\t\t\tas a colon-delimited array. \t\t\t\tNOTE: The :ref:`axes ` attribute is the preferred \t\t\t\tmethod of designating a link. \t\t\t\tDo not use the :ref:`axes ` attribute with the ``axis`` attribute. \t\t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . nxdetector:saturation_value a rdfs:Class ; rdfs:label "NXdetector/saturation_value" ; rdfs:comment """ The value at which the detector goes into saturation. Especially common to CCD detectors, the data is known to be invalid above this value. For example, given a saturation_value and an underload_value, the valid pixels are those less than or equal to the saturation_value and greater than or equal to the underload_value. The precise type should match the type of the data. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmonitor/sampled_fraction" ; rdfs:comment "Proportion of incident beam sampled by the monitor (0 ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxraylens/cylinder_orientation" ; rdfs:comment """ Orientation of the cylinder axis. """ ; rdfs:seeAlso ; rdfs:subClassOf , . nxdetector:frame_start_number a rdfs:Class ; rdfs:label "NXdetector/frame_start_number" ; rdfs:comment """ This is the start number of the first frame of a scan. In protein crystallography measurements one often scans a couple of frames on a give sample, then does something else, then returns to the same sample and scans some more frames. Each time with a new data file. This number helps concatenating such measurements. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtomophase/entry/sample" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcite/bibtex" ; rdfs:comment "Bibliographic reference data in BibTeX format." ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/SAMPLE/x_position" ; rdfs:comment "Location of the sample in :math:`x`" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtransformations" ; rdfs:comment """ \t\tCollection of axis-based translations and rotations to describe a geometry. \t\tMay also contain axes that do not move and therefore do not have a transformation \t\ttype specified, but are useful in understanding coordinate frames within which \t\ttransformations are done, or in documenting important directions, such as the \t\tdirection of gravity. \t\tA nested sequence of transformations lists the translation and rotation steps \t\tneeded to describe the position and orientation of any movable or fixed device. \t\tThere will be one or more transformations (axes) defined by one or more fields \t\tfor each transformation. Transformations can also be described by NXlog groups when \t\tthe values change with time. The all-caps name ``AXISNAME`` designates the \t\tparticular axis generating a transformation (e.g. a rotation axis or a translation \t\taxis or a general axis). The attribute ``units=\"NX_TRANSFORMATION\"`` designates the \t\tunits will be appropriate to the ``transformation_type`` attribute: \t\t* ``NX_LENGTH`` for ``translation`` \t\t* ``NX_ANGLE`` for ``rotation`` \t\t* ``NX_UNITLESS`` for axes for which no transformation type is specified \t\tThis class will usually contain all axes of a sample stage or goniometer or \t\ta detector. The NeXus default McSTAS coordinate frame is assumed, but additional \t\tuseful coordinate axes may be defined by using axes for which no transformation \t\ttype has been specified. \t\tThe entry point (``depends_on``) will be outside of this class and point to a \t\tfield in here. Following the chain may also require following ``depends_on`` \t\tlinks to transformations outside, for example to a common base table. If \t\ta relative path is given, it is relative to the group enclosing the ``depends_on`` \t\tspecification. \t\tFor a chain of three transformations, where :math:`T_1` depends on :math:`T_2` \t\tand that in turn depends on :math:`T_3`, the final transformation :math:`T_f` is \t\t.. math:: T_f = T_3 T_2 T_1 \t\tIn explicit terms, the transformations are a subset of affine transformations \t\texpressed as 4x4 matrices that act on homogeneous coordinates, :math:`w=(x,y,z,1)^T`. \t\tFor rotation and translation, \t\t.. math:: T_r &= \\begin{pmatrix} R & o \\\\ 0_3 & 1 \\end{pmatrix} \\\\ T_t &= \\begin{pmatrix} I_3 & t + o \\\\ 0_3 & 1 \\end{pmatrix} \t\twhere :math:`R` is the usual 3x3 rotation matrix, :math:`o` is an offset vector, \t\t:math:`0_3` is a row of 3 zeros, :math:`I_3` is the 3x3 identity matrix and \t\t:math:`t` is the translation vector. \t\t:math:`o` is given by the ``offset`` attribute, :math:`t` is given by the ``vector`` \t\tattribute multiplied by the field value, and :math:`R` is defined as a rotation \t\tabout an axis in the direction of ``vector``, of angle of the field value. \t\tNOTE \t\t \t\tOne possible use of ``NXtransformations`` is to define the motors and \t\ttransformations for a diffractometer (goniometer). Such use is mentioned \t\tin the ``NXinstrument`` base class. Use one ``NXtransformations`` group \t\tfor each diffractometer and name the group appropriate to the device. \t\tCollecting the motors of a sample table or xyz-stage in an NXtransformations \t\tgroup is equally possible. \t\tFollowing the section on the general dscription of axis in NXtransformations is a section which \t\tdocuments the fields commonly used within NeXus for positioning purposes and their meaning. Whenever \t\tthere is a need for positioning a beam line component please use the existing names. Use as many fields \t\tas needed in order to position the component. Feel free to add more axis if required. In the description \t\tgiven below, only those atttributes which are defined through the name are spcified. Add the other attributes \t\tof the full set: \t\t* vector \t\t* offset \t\t* transformation_type \t\t* depends_on \t\tas needed. \t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtomoproc/entry/data" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXfilter/unit_cell_a" ; rdfs:comment "Unit cell lattice parameter: length of side a" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtofraw/entry/SAMPLE" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/observed_px_x" ; rdfs:comment """ The estimate of the pixel x position at which the central impact of the reflection was recorded """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdetector_module/default" ; rdfs:comment """ .. index:: plotting Declares which child group contains a path leading to a :ref:`NXdata` group. It is recommended (as of NIAC2014) to use this attribute to help define the path to the default dataset to be plotted. See https://www.nexusformat.org/2014_How_to_find_default_data.html for a summary of the discussion. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXfluo/entry/INSTRUMENT/fluorescence" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreftof" ; rdfs:comment "This is an application definition for raw data from a TOF reflectometer. " ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXslit/y_gap" ; rdfs:comment """ Size of the gap opening in the second dimension of the local coordinate system. \t """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXinsertion_device/default" ; rdfs:comment """ .. index:: plotting Declares which child group contains a path leading to a :ref:`NXdata` group. It is recommended (as of NIAC2014) to use this attribute to help define the path to the default dataset to be plotted. See https://www.nexusformat.org/2014_How_to_find_default_data.html for a summary of the discussion. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmonochromator/energy_errors" ; rdfs:comment "energy standard deviation" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXpolarizer/reflection" ; rdfs:comment "[hkl] values of nominal reflection" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXpositioner/soft_limit_max" ; rdfs:comment "maximum allowed limit to set value" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsqom/ENTRY/instrument/SOURCE/probe" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXiqproc/ENTRY/definition" ; rdfs:comment " Official NeXus NXDL schema to which this file conforms " ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXtofraw/entry/SAMPLE/name" ; rdfs:comment "Descriptive name of sample" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXmonitor/GEOMETRY" ; rdfs:comment "Geometry of the monitor" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXsource/sigma_x" ; rdfs:comment "particle beam size in x" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/h/description" ; rdfs:comment "Describes the dataset " ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXguide/reflectivity/wavelength" ; rdfs:comment "wavelengths at which reflectivity was measured" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtomo/entry/control/data" ; rdfs:comment """ Total integral monitor counts for each measured frame. Allows a to correction for fluctuations in the beam between frames. \t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/int_sum_errors/description" ; rdfs:comment "Describes the dataset " ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmonochromator/VELOCITY_SELECTOR" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXslit" ; rdfs:comment """ \t\tA simple slit. \t\t \t\tFor more complex geometries, :ref:`NXaperture` should be used. \t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/INSTRUMENT/SOURCE/wavelength_min" ; rdfs:comment """ Some facilities specify wavelength using a range. This is the lowest wavelength in such a range. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdetector_group/group_index" ; rdfs:comment """ \t\t\tAn array of unique identifiers for detectors or groupings \t\t\tof detectors. \t\t\t \t\t\tEach ID is a unique ID for the corresponding detector or group \t\t\tnamed in the field group_names. The IDs are positive integers \t\t\tstarting with 1. \t \t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtas/entry/INSTRUMENT/monochromator" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXenvironment/name" ; rdfs:comment "Apparatus identification code/model number; e.g. OC100 011" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtomophase/entry/sample/z_translation" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXvelocity_selector/num" ; rdfs:comment "number of spokes/lamella" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/BEAM/incident_wavelength" ; rdfs:comment """ In the case of a monchromatic beam this is the scalar wavelength. Several other use cases are permitted, depending on the presence or absence of other incident_wavelength_X fields. In the case of a polychromatic beam this is an array of length **m** of wavelengths, with the relative weights in ``incident_wavelength_weights``. In the case of a monochromatic beam that varies shot- to-shot, this is an array of wavelengths, one for each recorded shot. Here, ``incident_wavelength_weights`` and incident_wavelength_spread are not set. In the case of a polychromatic beam that varies shot-to- shot, this is an array of length **m** with the relative weights in ``incident_wavelength_weights`` as a 2D array. In the case of a polychromatic beam that varies shot-to- shot and where the channels also vary, this is a 2D array of dimensions **nP** by **m** (slow to fast) with the relative weights in ``incident_wavelength_weights`` as a 2D array. Note, :ref:`variants ` are a good way to represent several of these use cases in a single dataset, e.g. if a calibrated, single-value wavelength value is available along with the original spectrum from which it was calibrated. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXdisk_chopper/depends_on" ; rdfs:comment """ NeXus positions components by applying a set of translations and rotations to apply to the component starting from 0, 0, 0. The order of these operations is critical and forms what NeXus calls a dependency chain. The depends_on field defines the path to the top most operation of the dependency chain or the string \".\" if located in the origin. Usually these operations are stored in a NXtransformations group. But NeXus allows them to be stored anywhere. The reference plane of the disk chopper includes the surface of the spinning disk which faces the source. The reference point in the x and y axis is the point on this surface which is the centre of the axle which the disk is spinning around. The reference plane is orthogonal to the z axis and its position is the reference point on that axis. Note: This reference point in almost all practical cases is not where the beam passes though. .. image:: disk_chopper/disk_chopper.png :width: 40% """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsqom/ENTRY/reduction/version" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/PROCESS/description" ; rdfs:comment "Optional description for this data processing or analysis step" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreftof/entry/instrument/detector/y_pixel_size" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsas/ENTRY/SAMPLE/aequatorial_angle" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXguide/number_sections" ; rdfs:comment """ \t number of substrate sections (also called ``nsurf`` as an \t index in the ``NXguide`` specification) """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtomophase/entry/instrument/sample/y_pixel_size" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/COLLECTION/canSAS_class" ; rdfs:comment """ Official canSAS group: :index:`NXcanSAS (applications); SASnote` """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmonitor/type" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXprocess/NOTE" ; rdfs:comment """ The note will contain information about how the data was processed or anything about the data provenance. The contents of the note can be anything that the processing code can understand, or simple text. The name will be numbered to allow for ordering of steps. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXspe/ENTRY/data/energy" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxbase/entry/definition" ; rdfs:comment " Official NeXus NXDL schema to which this file conforms " ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXreflections/prf_cc/description" ; rdfs:comment "Describes the dataset " ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsample/geometry" ; rdfs:comment "The position and orientation of the center of mass of the sample" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXxnb/entry/instrument" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/observed_phi_var/description" ; rdfs:comment "Describes the dataset " ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/INSTRUMENT/DETECTOR/x_pixel_size" ; rdfs:comment "Size of each detector pixel. If it is scalar all pixels are the same size" ; rdfs:seeAlso ; rdfs:subClassOf nxdetector:x_pixel_size , . a rdfs:Class ; rdfs:label "NXentry/thumbnail" ; rdfs:comment """ \t\t\tA small image that is representative of the entry. An example of this is a 640x480 \t\t\tjpeg image automatically produced by a low resolution plot of the NXdata. \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXxas/ENTRY/MONITOR" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtomo/entry/instrument/detector/x_pixel_size" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXaperture/TRANSFORMATIONS" ; rdfs:comment """ This is the group recommended for holding the chain of translation and rotation operations necessary to position the component within the instrument. The dependency chain may however traverse similar groups in other component groups. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NX_CROSS_SECTION" ; rdfs:comment """ \t\t\t\tunits of area (alias of NX_AREA) \t\t\t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/observed_y" ; rdfs:comment """ The estimate of the y position at which the central impact of the reflection was recorded """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsastof/ENTRY/instrument/detector/y_pixel_size" ; rdfs:comment "Size of a pixel in y direction" ; rdfs:seeAlso ; rdfs:subClassOf nxdetector:y_pixel_size , . a rdfs:Class ; rdfs:label "NXtas/entry/SAMPLE/qh" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXbeam/incident_wavelength" ; rdfs:comment """ In the case of a monochromatic beam this is the scalar wavelength. Several other use cases are permitted, depending on the presence or absence of other incident_wavelength_X fields. In the case of a polychromatic beam this is an array of length **m** of wavelengths, with the relative weights in ``incident_wavelength_weights``. In the case of a monochromatic beam that varies shot- to-shot, this is an array of wavelengths, one for each recorded shot. Here, ``incident_wavelength_weights`` and incident_wavelength_spread are not set. In the case of a polychromatic beam that varies shot-to- shot, this is an array of length **m** with the relative weights in ``incident_wavelength_weights`` as a 2D array. In the case of a polychromatic beam that varies shot-to- shot and where the channels also vary, this is a 2D array of dimensions **nP** by **m** (slow to fast) with the relative weights in ``incident_wavelength_weights`` as a 2D array. Note, :ref:`variants ` are a good way to represent several of these use cases in a single dataset, e.g. if a calibrated, single-value wavelength value is available along with the original spectrum from which it was calibrated. Wavelength on entering beamline component """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXspe" ; rdfs:comment "NXSPE Inelastic Format. Application definition for NXSPE file format. " ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXstxm/ENTRY/INSTRUMENT/sample_x/data" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/observed_frame_var" ; rdfs:comment """ The variance on the estimate of the frame at which the central impact of the reflection was recorded """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/observed_y_errors" ; rdfs:comment """ The standard deviation of the estimate of the y position at which the central impact of the reflection was recorded """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXoff_geometry/default" ; rdfs:comment """ .. index:: plotting Declares which child group contains a path leading to a :ref:`NXdata` group. It is recommended (as of NIAC2014) to use this attribute to help define the path to the default dataset to be plotted. See https://www.nexusformat.org/2014_How_to_find_default_data.html for a summary of the discussion. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtas/entry/SAMPLE/polar_angle" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxeuler/entry/instrument" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/DETECTOR/DETECTOR_MODULE" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsastof/ENTRY/data" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/DETECTOR/time_per_channel" ; rdfs:comment """ For a time-of-flight detector this is the scaling factor to convert from the numeric value reported to the flight time for a given measurement. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXgrating/coating_material" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/DETECTOR/flatfield_errors" ; rdfs:comment """ Errors of the flat field correction data. If provided, it is recommended that it be compressed. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/observed_phi_errors/description" ; rdfs:comment "Describes the dataset " ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmirror/figure_data" ; rdfs:comment "Numerical description of the surface figure of the mirror." ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXlog/maximum_value" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxbase/entry/instrument/detector/frame_start_number" ; rdfs:comment """ This is the start number of the first frame of a scan. In PX one often scans a couple of frames on a give sample, then does something else, then returns to the same sample and scans some more frames. Each time with a new data file. This number helps concatenating such measurements. """ ; rdfs:seeAlso ; rdfs:subClassOf nxdetector:frame_start_number , . a rdfs:Class ; rdfs:label "NXfresnel_zone_plate/zone_support_material" ; rdfs:comment "Material present between the zones. This is usually only present for the \"zone doubled\" fabrication process" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/reflection_id" ; rdfs:comment """ The id of the reflection. Multiple partials from the same reflection should all have the same id """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsource/last_fill/time" ; rdfs:comment "date and time of the most recent injection." ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsample_component/scattering_length_density" ; rdfs:comment "Scattering length density of component" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXroot/HDF_version" ; rdfs:comment "Version of HDF (version 4) library used in writing the file" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsample/point_group" ; rdfs:comment "Crystallographic point group, deprecated if space_group present" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdetector/y_pixel_offset/primary" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxlaueplate/entry/instrument/detector/diameter" ; rdfs:comment "The diameter of a cylindrical detector" ; rdfs:seeAlso ; rdfs:subClassOf nxdetector:diameter , . a rdfs:Class ; rdfs:label "NXentry/collection_time" ; rdfs:comment """ \t\t\tTime transpired actually collecting data i.e. taking out time when collection was \t\t\tsuspended due to e.g. temperature out of range \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxlaueplate/entry/definition" ; rdfs:comment " Official NeXus NXDL schema to which this file conforms " ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXarpes/ENTRY/INSTRUMENT/analyser/data" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsubentry/duration" ; rdfs:comment "Duration of measurement" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXnote/date" ; rdfs:comment "Date note created/added" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcite/description" ; rdfs:comment """ \t\t\tThis should describe the reason for including this reference. \t\t\tFor example: The dataset in this group was normalised using the method \t\t\twhich is described in detail in this reference. \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXarchive/entry/collection_time" ; rdfs:comment "TODO: needs documentation" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXparameters" ; rdfs:comment "Container for parameters, usually used in processing or analysis." ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsubentry/end_time" ; rdfs:comment "Ending time of measurement" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXgeometry/component_index" ; rdfs:comment """ \t Position of the component along the beam path. The sample is at 0, components upstream \t have negative component_index, components downstream have positive \t component_index. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/DETECTOR" ; rdfs:comment """ Normally the detector group will have the name ``detector``. However, in the case of multiple detectors, each detector needs a uniquely named NXdetector. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXfluo/entry/INSTRUMENT/SOURCE/type" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . nxdetector:number_of_cycles a rdfs:Class ; rdfs:label "NXdetector/number_of_cycles" ; rdfs:comment """ CCD images are sometimes constructed by summing together multiple short exposures in the electronics. This reduces background etc. This is the number of short exposures used to sum images for an image. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxasproc/ENTRY/definition" ; rdfs:comment " Official NeXus NXDL schema to which this file conforms " ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXsastof/ENTRY/control/mode" ; rdfs:comment " Count to a preset value based on either clock time (timer) or received monitor counts (monitor). " ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXentry/run_cycle" ; rdfs:comment "Such as \"2007-3\". Some user facilities organize their beam time into run cycles." ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsample" ; rdfs:comment """ \t\tAny information on the sample. \t\t \t\tThis could include scanned variables that \t\tare associated with one of the data dimensions, e.g. the magnetic field, or \t\tlogged data, e.g. monitored temperature vs elapsed time. \t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcrystal/unit_cell_a" ; rdfs:comment "Unit cell lattice parameter: length of side a" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdata/DATA/long_name" ; rdfs:comment "data label" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsample/unit_cell" ; rdfs:comment "Unit cell parameters (lengths and angles)" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/BEAM/incident_beam_size" ; rdfs:comment """ Two-element array of FWHM (if Gaussian or Airy function) or diameters (if top hat) or widths (if rectangular) of the beam in the order x, y """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtofnpd/entry/INSTRUMENT/detector/distance" ; rdfs:comment "distance to sample for each detector" ; rdfs:seeAlso ; rdfs:subClassOf nxdetector:distance , . a rdfs:Class ; rdfs:label "NXreflections/observed_phi_errors" ; rdfs:comment """ The standard deviation of the estimate of the phi angle at which the central impact of the reflection was recorded """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXarpes/ENTRY/INSTRUMENT/SOURCE/probe" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXscan/ENTRY/INSTRUMENT" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXmoderator/depends_on" ; rdfs:comment """ NeXus positions components by applying a set of translations and rotations to apply to the component starting from 0, 0, 0. The order of these operations is critical and forms what NeXus calls a dependency chain. The depends_on field defines the path to the top most operation of the dependency chain or the string \".\" if located in the origin. Usually these operations are stored in a NXtransformations group. But NeXus allows them to be stored anywhere. The reference point of the moderator is its center in the x and y axis. The reference point on the z axis is the surface of the moderator pointing towards the source (the negative part of the z axis). .. image:: moderator/moderator.png :width: 40% """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdirecttof/entry/INSTRUMENT/fermi_chopper/rotation_speed" ; rdfs:comment "chopper rotation speed" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXdata/axes" ; rdfs:comment """ \t\t\t.. index:: plotting \t\t\t \t\t\tThe ``axes`` attribute is a list of strings which are the names of the :ref:`AXISNAME ` fields \t\t\tthat contain the values of the coordinates along the :ref:`data ` dimensions. \t\t\t.. note:: When ``axes`` contains multiple strings, it must be saved as an actual array \t\t\t\tof strings and not a single comma separated string. \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsubentry/thumbnail" ; rdfs:comment """ \t\t\tA small image that is representative of the entry. An example of this is a 640x480 \t\t\tjpeg image automatically produced by a low resolution plot of the NXdata. \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXinstrument/MONOCHROMATOR" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXgeometry" ; rdfs:comment """ legacy class - recommend to use :ref:`NXtransformations` now It is recommended that instances of :ref:`NXgeometry` be converted to use :ref:`NXtransformations`. This is the description for a general position of a component. It is recommended to name an instance of :ref:`NXgeometry` as \"geometry\" to aid in the use of the definition in simulation codes such as McStas. Also, in HDF, linked items must share the same name. However, it might not be possible or practical in all situations. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXfermi_chopper/rotation_speed" ; rdfs:comment "chopper rotation speed" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/observed_px_y/description" ; rdfs:comment "Describes the dataset " ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxlaue/entry/instrument/source/distribution/data" ; rdfs:comment "expect ``signal=1 axes=\"energy\"``" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXbeam/final_wavelength" ; rdfs:comment "Wavelength on leaving beamline component" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxraylens/lens_length" ; rdfs:comment "Length of the lens" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXbending_magnet/source_distance_x" ; rdfs:comment """ Distance of source point from particle beam waist in X (horizontal) direction. Note, it is recommended to use NXtransformations instead to place component. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdirecttof/entry/definition" ; rdfs:comment " Official NeXus NXDL schema to which this file conforms " ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXsubentry/experiment_identifier" ; rdfs:comment """ \t\t\tUnique identifier for the experiment, defined by \t\t\tthe facility, possibly linked to the proposals \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXfilter/chemical_formula" ; rdfs:comment """ \t\t\tThe chemical formula specified using CIF conventions. \t\t\tAbbreviated version of CIF standard: \t\t\t \t\t\t* Only recognized element symbols may be used. \t\t\t* Each element symbol is followed by a 'count' number. A count of '1' may be omitted. \t\t\t* A space or parenthesis must separate each cluster of (element symbol + count). \t\t\t* Where a group of elements is enclosed in parentheses, the multiplier for the \t\t\t group must follow the closing parentheses. That is, all element and group \t\t\t multipliers are assumed to be printed as subscripted numbers. \t\t\t* Unless the elements are ordered in a manner that corresponds to their chemical \t\t\t structure, the order of the elements within any group or moiety depends on \t\t\t whether or not carbon is present. \t\t\t* If carbon is present, the order should be: \t\t\t \t\t\t * C, then H, then the other elements in alphabetical order of their symbol. \t\t\t * If carbon is not present, the elements are listed purely in alphabetic order of their symbol. \t\t\t \t\t\t* This is the *Hill* system used by Chemical Abstracts. \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxbase/entry/DATA" ; rdfs:comment """ The name of this group id data if there is only one detector; if there are several the names will be data1, data2, data3 and will point to the corresponding detector groups in the instrument hierarchy. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXsubentry/title" ; rdfs:comment "Extended title for entry" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsastof/ENTRY/instrument/detector/x_pixel_size" ; rdfs:comment "Physical size of a pixel in x-direction" ; rdfs:seeAlso ; rdfs:subClassOf nxdetector:x_pixel_size , . a rdfs:Class ; rdfs:label "NXmoderator/poison_material" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmonopd/entry/INSTRUMENT/SOURCE/type" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NX_WAVELENGTH" ; rdfs:comment """ \t\t\t\tunits of wavelength \t\t\t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXinstrument/COLLIMATOR" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXgrating/substrate_thickness" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXbending_magnet/magnetic_field" ; rdfs:comment "strength of magnetic field of dipole magnets" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtomophase/entry/sample/y_translation" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxnb/entry" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXinsertion_device/length" ; rdfs:comment "length of insertion device" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdetector_module/fast_pixel_direction/offset" ; rdfs:comment """ \t\t\t\tA fixed offset applied before the transformation (three vector components). \t\t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:comment "NeXus Attribute" ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXarpes/ENTRY/SAMPLE" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXpolarizer/TRANSFORMATIONS" ; rdfs:comment """ This is the group recommended for holding the chain of translation and rotation operations necessary to position the component within the instrument. The dependency chain may however traverse similar groups in other component groups. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXiqproc/ENTRY/instrument/SOURCE/name" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtomophase/entry/start_time" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcrystal/unit_cell" ; rdfs:comment "Unit cell parameters (lengths and angles)" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXspe/ENTRY/data/polar_width" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXbending_magnet/spectrum" ; rdfs:comment "bending magnet spectrum" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXarpes/ENTRY/start_time" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXinstrument/DIFFRACTOMETER" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXarchive/entry/revision" ; rdfs:comment "revision ID of this file, may be after recalibration, reprocessing etc." ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXscan/ENTRY/start_time" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXpolarizer/type" ; rdfs:comment "one of these values: \"crystal\", \"supermirror\", \"3He\"" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcollimator/type" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXinstrument/BEAM" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXspe/ENTRY/SAMPLE/temperature" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXfluo/entry" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXorientation/value" ; rdfs:comment """ \t\t\tThe orientation information is stored as direction cosines. The direction cosines will \t\t\tbe between the local coordinate directions and the reference directions (to origin or \t\t\trelative NXgeometry). Calling the local unit vectors (x',y',z') and the reference unit \t\t\tvectors (x,y,z) the six numbers will be [x' dot x, x' dot y, x' dot z, y' dot x, y' dot \t\t\ty, y' dot z] where \"dot\" is the scalar dot product (cosine of the angle between the unit \t\t\tvectors). The unit vectors in both the local and reference coordinates are right-handed \t\t\tand orthonormal. \t\t\t \t\t\tThe pair of groups NXtranslation and NXorientation together \t\t\tdescribe the position of a component. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsqom" ; rdfs:comment """ This is the application definition for S(Q,OM) processed data. As this kind of data is in general not on a rectangular grid after data reduction, it is stored as Q,E positions plus their intensity, table like. It is the task of a possible visualisation program to regrid this data in a sensible way. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXuser/fax_number" ; rdfs:comment "Fax number of user" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/DATA/Idev/units" ; rdfs:comment """ Engineering units to use when expressing :math:`I` and intensity-related terms. Data expressed in other units (or missing a ``@units`` attribute) will generate a warning from any validation process and will be treated as ``arbitrary`` by some analysis software packages. For software using the UDUNITS-2 library, ``arbitrary`` will be changed to ``unknown`` for handling with that library. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtofsingle/entry/title" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/SAMPLE/thickness" ; rdfs:comment "Thickness of this sample" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXrefscan/entry/sample/name" ; rdfs:comment "Descriptive name of sample" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXstxm/ENTRY/end_time" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXarchive/entry/program/version" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/predicted_x/description" ; rdfs:comment "Describes the dataset " ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXscan/ENTRY/title" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NX_DATE_TIME" ; rdfs:comment """ \t\t\tAlias for the ``ISO8601`` date/time stamp. \t\t\tIt is recommended to add an explicit time zone, \t\t\totherwise the local time zone is assumed per ISO8601. \t\t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS" ; rdfs:comment """ Implementation of the canSAS standard to store reduced small-angle scattering data of any dimension. .. index:: canSAS For more details, see: * http://www.cansas.org/ * http://www.cansas.org/formats/canSAS1d/1.1/doc/ * http://cansas-org.github.io/canSAS2012/ * https://github.com/canSAS-org/NXcanSAS_examples The minimum requirements for *reduced* small-angle scattering data as described by canSAS are summarized in the following figure: .. _canSAS_2012_minimum: .. figure:: canSAS/2012-minimum.png :width: 60% The minimum requirements for *reduced* small-angle scattering data. (:download:`full image `) See :ref:`below ` for the minimum required information for a NeXus data file written to the NXcanSAS specification. .. rubric:: Implementation of canSAS standard in NeXus This application definition is an implementation of the canSAS standard for storing both one-dimensional and multi-dimensional *reduced* small-angle scattering data. * NXcanSAS is for reduced SAS data and metadata to be stored together in one file. * *Reduced* SAS data consists of :math:`I(\\vec{Q})` or :math:`I(|\\vec{Q}|)` * External file links are not to be used for the reduced data. * A good practice/practise is, at least, to include a reference to how the data was acquired and processed. Yet this is not a requirement. * There is no need for NXcanSAS to refer to any raw data. The canSAS data format has a structure similar to NeXus, not identical. To allow canSAS data to be expressed in NeXus, yet identifiable by the canSAS standard, an additional group attribute ``canSAS_class`` was introduced. Here is the mapping of some common groups. =============== ============ ========================== group (*) NX_class canSAS_class =============== ============ ========================== sasentry NXentry SASentry sasdata NXdata SASdata sasdetector NXdetector SASdetector sasinstrument NXinstrument SASinstrument sasnote NXnote SASnote sasprocess NXprocess SASprocess sasprocessnote NXcollection SASprocessnote sastransmission NXdata SAStransmission_spectrum sassample NXsample SASsample sassource NXsource SASsource =============== ============ ========================== (*) The name of each group is a suggestion, not a fixed requirement and is chosen as fits each data file. See the section on defining :ref:`NXDL group and field names `. Refer to the NeXus Coordinate System drawing (:ref:`Design-CoordinateSystem`) for choice and direction of :math:`x`, :math:`y`, and :math:`z` axes. .. _NXcanSAS_minimum: .. rubric:: The minimum required information for a NeXus data file written to the NXcanSAS specification. .. literalinclude:: canSAS/minimum-required.txt :tab-width: 4 :linenos: :language: text """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsource/pulse_width" ; rdfs:comment "temporal width of source pulse" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcollimator/blade_thickness" ; rdfs:comment "blade thickness" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/DETECTOR/depends_on" ; rdfs:comment """ NeXus path to the detector positioner axis that most directly supports the detector. In the case of a single-module detector, the detector axis chain may start here. """ ; rdfs:seeAlso ; rdfs:subClassOf nxdetector:depends_on , . a rdfs:Class ; rdfs:label "NXpositioner/depends_on" ; rdfs:comment """ NeXus positions components by applying a set of translations and rotations to apply to the component starting from 0, 0, 0. The order of these operations is critical and forms what NeXus calls a dependency chain. The depends_on field defines the path to the top most operation of the dependency chain or the string \".\" if located in the origin. Usually these operations are stored in a NXtransformations group. But NeXus allows them to be stored anywhere. .. todo:: Add a definition for the reference point of a positioner. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxraylens/default" ; rdfs:comment """ .. index:: plotting Declares which child group contains a path leading to a :ref:`NXdata` group. It is recommended (as of NIAC2014) to use this attribute to help define the path to the default dataset to be plotted. See https://www.nexusformat.org/2014_How_to_find_default_data.html for a summary of the discussion. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtomoproc/entry/data/data/offset" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxeuler/entry/instrument/detector" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXuser/telephone_number" ; rdfs:comment "Telephone number of user" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtofsingle/entry/data" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXbeam/final_energy" ; rdfs:comment "Energy carried by each particle of the beam on leaving the beamline component" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXbending_magnet/OFF_GEOMETRY" ; rdfs:comment """ This group describes the shape of the beam line component """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXspe/ENTRY/SAMPLE" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXgrating" ; rdfs:comment "A diffraction grating, as could be used in a soft X-ray monochromator" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsample/magnetic_field_log" ; rdfs:comment "magnetic_field_log.value is a link to e.g. magnetic_field_env.sensor1.value_log.value" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXtomoproc/entry/INSTRUMENT/SOURCE" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtomophase/entry/definition" ; rdfs:comment " Official NeXus NXDL schema to which this file conforms " ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXreftof/entry/instrument/name" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXslit/x_gap" ; rdfs:comment """ Size of the gap opening in the first dimension of the local coordinate system. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxrot/entry/instrument/attenuator/attenuator_transmission" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXcite" ; rdfs:comment """ \t\tA literature reference \t\t \t\tDefinition to include references for example for detectors, \t\tmanuals, instruments, acquisition or analysis software used. \t\t \t\tThe idea would be to include this in the relevant NeXus object: \t\t:ref:`NXdetector` for detectors, :ref:`NXinstrument` for instruments, etc. \t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdirecttof/entry/INSTRUMENT/disk_chopper/rotation_speed" ; rdfs:comment "chopper rotation speed" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXdetector_module/module_offset/vector" ; rdfs:comment """ \t\t\t\tThree values that define the axis for this transformation \t\t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXvelocity_selector/geometry" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/ATTENUATOR" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXevent_data/event_time_zero/offset" ; rdfs:comment "ISO8601" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsample/magnetic_field_env" ; rdfs:comment "Additional sample magnetic environment information" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXshape" ; rdfs:comment """ \t\tlegacy class - (used by :ref:`NXgeometry`) - the shape and size of a component. \t\t \t\tThis is the description of the general shape and size of a \t\tcomponent, which may be made up of ``numobj`` separate \t\telements - it is used by the :ref:`NXgeometry` class \t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/INSTRUMENT/DETECTOR/roll" ; rdfs:comment "Rotation of the detector about the :math:`z` axis (roll)" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxas/ENTRY/start_time" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxrot/entry/name" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsubentry/pre_sample_flightpath" ; rdfs:comment """ \t\t\tThis is the flightpath before the sample position. This can be determined by a chopper, \t\t\tby the moderator or the source itself. In other words: it the distance to the component \t\t\twhich gives the T0 signal to the detector electronics. If another component in the \t\t\tNXinstrument hierarchy provides this information, this should be a link. \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/DATA/dQw" ; rdfs:comment """ .. index:: NXcanSAS (applications); dQw :math:`Q` **resolution** along the axis of scanning (the high-resolution *slit width* direction). Useful for defining resolution data from slit-smearing instruments such as Bonse-Hart geometry. Must have the same units as :math:`Q`. When present, the name of this field is also recorded in the *resolutions* attribute of *Q*, as in:: Q/@resolutions=\"dQw\", \"dQl\" """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXentry/experiment_identifier" ; rdfs:comment """ \t\t\tUnique identifier for the experiment, \t\t\tdefined by the facility, \t\t\tpossibly linked to the proposals \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdisk_chopper/slit_edges" ; rdfs:comment """ \t\t\tAngle of each edge of every slit from the position of the \t\t\ttop-dead-center timestamp sensor, anticlockwise when facing \t\t\taway from the source. \t\t\tThe first edge must be the opening edge of a slit, thus the last edge \t\t\tmay have an angle greater than 360 degrees. \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdetector/TRANSFORMATIONS" ; rdfs:comment """ This is the group recommended for holding the chain of translation and rotation operations necessary to position the component within the instrument. The dependency chain may however traverse similar groups in other component groups. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXsastof/ENTRY/instrument/source/name" ; rdfs:comment "Name of the radiation source" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXstxm/ENTRY/DATA/sample_x" ; rdfs:comment """ List of X positions on the sample. If scanned through multiple values, then an 'axis' attribute will be required to link the field to the appropriate data array dimension.""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NX_UNITLESS" ; rdfs:comment """ \t\t\t\tfor fields that don't have a unit (e.g. hkl) so that they don't \t\t\t\tinherit the wrong units (NOTE: not the same as NX_DIMENSIONLESS) \t\t\t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXfluo" ; rdfs:comment """ This is an application definition for raw data from an X-ray fluorescence experiment """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NeXusDataType" ; rdfs:comment "any valid NeXus field or attribute type" ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXinsertion_device/taper" ; rdfs:comment "angular of gap difference between upstream and downstream ends of the insertion device" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdata/x" ; rdfs:comment """ \t\t\tThis is an array holding the values to use for the x-axis of \t\t\tdata. The units must be appropriate for the measurement. \t\t\tThis is a special case of a :ref:`AXISNAME field ` \t\t\tkept for backward compatiblity. \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/DATA/Q/resolutions_description" ; rdfs:comment """ (optional) Generally, this describes the :math:`Q` ``@resolutions`` data object. By default, the value is assumed to be \"Gaussian\". These are suggestions: * Gaussian * Lorentzian * Square : note that the full width of the square would be ~2.9 times the standard deviation specified in the vector * Triangular * Sawtooth-outward : vertical edge pointing to larger Q * Sawtooth-inward vertical edge pointing to smaller Q * Bin : range of values contributing (for example, when 2-D detector data have been reduced to a 1-D :math:`I(|Q|)` dataset) For other meanings, it may be necessary to provide further details such as the function used to assess the resolution. In such cases, use additional datasets or a :ref:`NXnote` subgroup to include that detail. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXlauetof/entry" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXsample/orientation_matrix" ; rdfs:comment """ \t\t\tOrientation matrix of single crystal sample using Busing-Levy convention: \t\t\tW. R. Busing and H. A. Levy (1967). Acta Cryst. 22, 457-464 \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXbeam/incident_wavelength_weights" ; rdfs:comment """ In the case of a polychromatic beam this is an array of length **m** of the relative weights of the corresponding wavelengths in ``incident_wavelength``. In the case of a polychromatic beam that varies shot-to- shot, this is a 2D array of dimensions **nP** by **m** (slow to fast) of the relative weights of the corresponding wavelengths in ``incident_wavelength``. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NX_INT" ; rdfs:comment "any representation of an integer number" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/BEAM/flux" ; rdfs:comment """ Which field contains the measured flux. One of ``flux``, ``total_flux``, ``flux_integrated``, or ``total_flux_integrated``. Alternatively, the name being indicated could be a link to a dataset in an NXmonitor group that records per shot beam data. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXarchive/entry/instrument/SOURCE/name" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtomophase/entry/instrument/SOURCE/probe" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXparameters/term/units" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/predicted_frame/description" ; rdfs:comment "Describes the dataset " ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmonitor/preset" ; rdfs:comment "preset value for time or monitor" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtomoproc" ; rdfs:comment "This is an application definition for the final result of a tomography experiment: a 3D construction of some volume of physical properties." ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXvelocity_selector/radius" ; rdfs:comment "radius at beam centre" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/id" ; rdfs:comment """ The id of the experiment which resulted in the reflection. If the value is greater than 0, the experiments must link to a multi-experiment NXmx group """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcrystal/TRANSFORMATIONS" ; rdfs:comment """ Transformations used by this component to define its position and orientation. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXtomo" ; rdfs:comment """ This is the application definition for x-ray or neutron tomography raw data. In tomography a number of dark field images are measured, some bright field images and, of course the sample. In order to distinguish between them images carry a image_key. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/DETECTOR/DETECTOR_MODULE/module_offset/vector" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXprocess/version" ; rdfs:comment "Version of the program used" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXbeam/flux" ; rdfs:comment "flux incident on beam plane area" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/prf_cc" ; rdfs:comment """ The correlation of the reflection profile with the reference profile used in profile fitting """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXpdb" ; rdfs:comment """ \t\tA NeXus transliteration of a PDB file, to be validated only as a PDB \t\trather than in NeXus. \t\tUse :ref:`NXpdb` to incorporate the information in an arbitrary \t\tPDB into a NeXus file. \t\tThe main suggestion is to use this as a container \t\tclass for a PDB entry to describe a sample in NXsample, \t\tbut it may be more appropriate to place this higher in the \t\thierarchy, say in NXentry. \t\tThe structure has to follow the structure of a PDB \t\twith each PDB data block mapped to a NeXus group of class NXpdb, \t\tusing a lowercase version of the data block name as the name \t\tof the NeXus group, each PDB category in that data block \t\tmapped to a NeXus group of class NXpdb and with each PDB column \t\tmapped to a NeXus field. Each column in a looped PDB category \t\tshould always be presented as a 1-dimensional array. The columns \t\tin an unlooped PDB category should be presented as scalar values. \t\tIf a PDB category specifies particular units for columns, the same \t\tunits should beused for the corresponding fields. \t\tA PDB entry is unambigous when all information is carried as text. \t\tAll text data should be presented as quoted strings, with the quote \t\tmarks except for the null values \".\" or \"?\" \t\tFor clarity in NXpdb form, numeric data may be presented using the \t\tnumeric types specified in the mmCIF dictionary. In that case, \t\tif a PDB null value, \".\" or \"?\", is contained in a numeric column, the \t\tIEEE nan should be used for \"?\" and the IEEE inf should be used for \".\". \t\tAn arbitrary DDL2 CIF file can be represented in NeXus using NXpdb. \t\tHowever, if save frames are required, an NXpdb_class attribute with the \t\tvalue \"CBF_cbfsf\" is required for each NeXus group representing a save \t\tframe. NXpdb attributes are not required for other CIF components, \t\tbut may be used to provide internal documentation. \t\tThe nesting of NXpdb groups and datasets that correspond to a CIF with \t\ttwo categories and one saveframe, including the NXpdb_class attribues is:: \t\t\t(datablock1):NXpdb \t\t\t @NXpdb_class:CBF_cbfdb \t\t\t (category1):NXpdb \t\t\t @NXpdb_class:CBF_cbfcat \t\t\t (column_name1):[...] \t\t\t (column_name2):[...] \t\t\t (column_name3):[...] \t\t\t ... \t\t\t (category2):NXpdb \t\t\t @NXpdb_class:CBF_cbfcat \t\t\t (column_name4):[...] \t\t\t (column_name5):[...] \t\t\t (column_name6):[...] \t\t\t ... \t\t\t (saveframe1):NXpdb \t\t\t @NXpdb_class:CBF_cbfsf \t\t\t (category3):NXpdb \t\t\t @NXpdb_class:CBF_cbfcat \t\t\t (column_name7):[...] \t\t\t (column_name8):[...] \t\t\t (column_name9):[...] \t\t\t ... \t\t\t ... \t\t\t ... \t\t\t \t\tFor example, a PDB entry that begins:: \t\t\tdata_1YVA \t\t\t# \t\t\t _entry.id 1YVA \t\t\t# \t\t\t_audit_conform.dict_name mmcif_pdbx.dic \t\t\t_audit_conform.dict_version 5.279 \t\t\t_audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic \t\t\t# \t\t\tloop_ \t\t\t_database_2.database_id \t\t\t_database_2.database_code \t\t\tPDB 1YVA \t\t\tRCSB RCSB031959 \t\t\tWWPDB D_1000031959 \t\t\t# \t\twould produce:: \t \t\t\tsample:NXsample \t\t\t 1yva:NXpdb \t\t\t entry:NXpdb \t\t\t\t id:\"1YVA\" \t\t\t audit_conform:NXpdb \t\t\t\t dict_name:\"mmcif_pdbx.dic\" \t\t\t\t dict_version:\"5.279\" \t\t\t\t dict_location:\"http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic\" \t\t\t database_2:NXpdb \t\t\t\t database_id:[\"PDB\",\"RCSB\",\"WWPDB\"] \t\t\t\t database_code:[\"1YVA\",\"RCSB031959\",\"D_1000031959\"] \t\tanother example is the following excerpt from pdb entry 9ins, giving the sequences \t\tof the two chains:: \t\t\tloop_ \t\t\t_entity_poly.entity_id \t\t\t_entity_poly.nstd_linkage \t\t\t_entity_poly.nstd_monomer \t\t\t_entity_poly.pdbx_seq_one_letter_code \t\t\t_entity_poly.pdbx_seq_one_letter_code_can \t\t\t_entity_poly.type \t\t\t1 no no GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN polypeptide(L) \t\t\t2 no no FVNQHLCGSHLVEALYLVCGERGFFYTPKA FVNQHLCGSHLVEALYLVCGERGFFYTPKA \t\t\tpolypeptide(L) \t\twhich converts to:: \t\t\tentity_poly:NXpdb \t\t\t @NXpdb_class:CBF_cbfcat \t\t\t entity_id:[\"1\", \"2\"] \t\t\t nstd_linkage:[\"no\", \"no\"] \t\t\t nstd_monomer:[\"no\", \"no\"] \t\t\t pdbx_seq_one_letter_code:[\"GIVEQCCTSICSLYQLENYCN\",\"FVNQHLCGSHLVEALYLVCGERGFFYTPKA\"] \t\t\t pdbx_seq_one_letter_code_can:[\"GIVEQCCTSICSLYQLENYCN\",\"FVNQHLCGSHLVEALYLVCGERGFFYTPKA\"] \t\t\t type:[\"polypeptide(L)\", \"polypeptide(L)\"] \t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdetector_channel/underload_value" ; rdfs:comment """ The lowest value at which pixels for this detector would be reasonably measured. The data is known to be invalid below this value. For example, given a saturation_value and an underload_value, the valid pixels are those less than or equal to the saturation_value and greater than or equal to the underload_value. The precise type should match the type of the data. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXfluo/entry/INSTRUMENT/monochromator" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXbeam/TRANSFORMATIONS/DIRECTION/offset" ; rdfs:comment """ Three values that define the location of a point through which the beam passes """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/DATA/dQw/units" ; rdfs:comment """ Engineering units to use when expressing :math:`Q` and related terms. Data expressed in other units may not be processed by some software packages. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsensor/name" ; rdfs:comment "Name for the sensor" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxasproc/ENTRY/XAS_data_reduction/parameters" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXstxm/ENTRY/INSTRUMENT/sample_y/data" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXguide/coating_roughness" ; rdfs:comment "TODO: documentation needed" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdetector_channel/pixel_mask_applied" ; rdfs:comment """ True when the pixel mask correction has been applied in the electronics, false otherwise. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcapillary/gain" ; rdfs:comment """ The gain of the capillary as a function of energy """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXguide/reflectivity/surface_indices" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXbeam/TRANSFORMATIONS/reference_plane/vector" ; rdfs:comment """ Three values that define the direction of reference plane normal """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXentry/PARAMETERS" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXfresnel_zone_plate/outer_diameter" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxeuler/entry" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXshape/default" ; rdfs:comment """ .. index:: plotting Declares which child group contains a path leading to a :ref:`NXdata` group. It is recommended (as of NIAC2014) to use this attribute to help define the path to the default dataset to be plotted. See https://www.nexusformat.org/2014_How_to_find_default_data.html for a summary of the discussion. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtofnpd/entry/INSTRUMENT" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXtas/entry/INSTRUMENT/SOURCE/probe" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXsample/x_translation" ; rdfs:comment """ \t\t\tTranslation of the sample along the X-direction of the laboratory coordinate system \t\t\tNote, it is recommended to use NXtransformations instead. \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . nxdetector:solid_angle a rdfs:Class ; rdfs:label "NXdetector/solid_angle" ; rdfs:comment "Solid angle subtended by the detector at the sample" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxbase/entry/instrument/detector/distance" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsas/ENTRY/definition" ; rdfs:comment "Official NeXus NXDL schema to which this file conforms." ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXdisk_chopper/ratio" ; rdfs:comment """ \t\t\tPulse reduction factor of this chopper in relation to other \t\t\tchoppers/fastest pulse in the instrument \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXarpes/ENTRY/INSTRUMENT/monochromator" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsource/probe" ; rdfs:comment "type of radiation probe (pick one from the enumerated list and spell exactly)" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/lp/description" ; rdfs:comment "Describes the dataset " ; rdfs:seeAlso ; rdfs:subClassOf . nxdetector:y_pixel_offset a rdfs:Class ; rdfs:label "NXdetector/y_pixel_offset" ; rdfs:comment """ Offset from the detector center in the y-direction. Can be multidimensional when different values are required for each pixel. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcrystal/reflectivity" ; rdfs:comment "crystal reflectivity versus wavelength" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXsensor/external_field_full" ; rdfs:comment "For complex external fields not satisfied by External_field_brief" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXsensor/measurement" ; rdfs:comment "name for measured signal" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/BEAM/profile" ; rdfs:comment """ The beam profile, Gaussian, Airy function, top-hat or rectangular. The profile is given in the plane of incidence of the beam on the sample. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/BEAM/incident_wavelength_weight" ; rdfs:comment """ In the case of a polychromatic beam this is an array of length **m** of the relative weights of the corresponding wavelengths in incident_wavelength. In the case of a polychromatic beam that varies shot-to- shot, this is a 2D array of dimensions **nP** by **m** (slow to fast) of the relative weights of the corresponding wavelengths in incident_wavelength. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtas/entry/INSTRUMENT/analyser/rotation_angle" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXrefscan/entry/sample" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXevent_data/event_index" ; rdfs:comment """ \t The index into the event_time_offset, event_id pair for \t the pulse occurring at the matching entry in event_time_zero. \t """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxbase/entry/instrument/detector/data/signal" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/DATA/Q" ; rdfs:comment """ .. index:: NXcanSAS (applications); Q \t\t\t Array of :math:`Q` data to accompany :math:`I`. .. figure:: canSAS/Q-geometry.jpg \t:width: 60% \tThe :math:`\\vec{Q}` geometry. \t(:download:`full image `) :math:`Q` may be represented as either the three-dimensional scattering vector :math:`\\vec{Q}` or the magnitude of the scattering vector, :math:`|\\vec{Q}|`. .. math:: |\\vec{Q}| = (4\\pi/\\lambda) sin(\\theta) When we write :math:`Q`, we may refer to either or both of :math:`|\\vec{Q}|` or :math:`\\vec{Q}`, depending on the context. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXlog/time" ; rdfs:comment """ \t\t\tTime of logged entry. The times are relative to the \"start\" attribute \t\t\tand in the units specified in the \"units\" \t\t\tattribute. Please note that absolute \t\t\ttimestamps under unix are relative to ``1970-01-01T00:00:00.0Z``. \t\t\tThe scaling_factor, when present, has to be applied to the time values in order \t\t\tto arrive at the units specified in the units attribute. The scaling_factor allows \t\t\tfor arbitrary time units such as ticks of some hardware clock. \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsample/stress_field/direction" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/observed_x_var/description" ; rdfs:comment "Describes the dataset " ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXlog/time/scaling_factor" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/name/short_name" ; rdfs:comment "Short name for instrument, perhaps the acronym." ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXguide/OFF_GEOMETRY" ; rdfs:comment """ This group describes the shape of the beam line component """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXsubentry/program_name/configuration" ; rdfs:comment "configuration of the program" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmirror/layer_thickness" ; rdfs:comment " An array describing the thickness of each layer" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsensor/value_deriv1_log" ; rdfs:comment "Time history of first derivative of sensor readings" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXlog/average_value_error" ; rdfs:comment "estimated uncertainty (often used: standard deviation) of average_value" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxasproc/ENTRY/SAMPLE" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXiqproc/ENTRY/SAMPLE/name" ; rdfs:comment "Descriptive name of sample" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXmirror/GEOMETRY" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXlauetof/entry/instrument/detector/data" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtas/entry/SAMPLE/rotation_angle" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtofnpd/entry/INSTRUMENT/detector/time_of_flight" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXspe/ENTRY/data/error" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmonochromator/wavelength_errors" ; rdfs:comment "wavelength standard deviation" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/DATA/I_axes" ; rdfs:comment """ String array that defines the independent data fields used in the default plot for all of the dimensions of the *signal* field (the *signal* field is the field in this group that is named by the ``signal`` attribute of this group). One entry is provided for every dimension of the ``I`` data object. Such as:: @I_axes=\"Temperature\", \"Time\", \"Pressure\", \"Q\", \"Q\" Since there are five items in the list, the intensity field of this example ``I`` must be a five-dimensional array (rank=5). """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxas/ENTRY/INSTRUMENT/SOURCE/name" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmoderator/distance" ; rdfs:comment """ Effective distance as seen by measuring radiation. Note, it is recommended to use NXtransformations instead. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsample/temperature" ; rdfs:comment "Sample temperature. This could be a scanned variable" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXguide/substrate_thickness" ; rdfs:comment "TODO: documentation needed" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/COLLECTION" ; rdfs:comment """ Free form description of anything not covered by other elements. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXdetector/crate/local_name" ; rdfs:comment "Equivalent local term" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsubentry/definition_local/URL" ; rdfs:comment "URL of NXDL file" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXstxm/ENTRY/INSTRUMENT/SOURCE" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/DETECTOR/description" ; rdfs:comment """ name/manufacturer/model/etc. information. """ ; rdfs:seeAlso ; rdfs:subClassOf nxdetector:description , . a rdfs:Class ; rdfs:label "NXmonitor/integral" ; rdfs:comment "Total integral monitor counts" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdata/default_slice" ; rdfs:comment """ \t\t\tWhich slice of data to show in a plot by default. This is useful especially for \t\t\tdatasets with more than 2 dimensions. \t\t\tShould be an array of length equal to the number of dimensions \t\t\tin the data, with the following possible values: \t\t\t* \".\": All the data in this dimension should be included \t\t\t* Integer: Only this slice should be used. \t\t\t* String: Only this slice should be used. Use if ``AXISNAME`` is a string \t\t\t array. \t\t\tExample:: \t\t\t data:NXdata \t\t\t\t@signal = \"data\" \t\t\t\t@axes = [\"image_id\", \"channel\", \".\", \".\"] \t\t\t\t@image_id_indices = 0 \t\t\t\t@channel_indices = 1 \t\t\t\t@default_slice = [\".\", \"difference\", \".\", \".\"] \t\t\t\timage_id = [1, ..., nP] \t\t\t\tchannel = [\"threshold_1\", \"threshold_2\", \"difference\"] \t\t\t\tdata = uint[nP, nC, i, j] \t\t\tHere, a data array with four dimensions, including the number of images \t\t\t(nP) and number of channels (nC), specifies more dimensions than can be \t\t\tvisualized with a 2D image viewer for a given image. Therefore the \t\t\tdefault_slice attribute specifies that the \"difference\" channel should be \t\t\tshown by default. \t\t\tAlternate version using an integer would look like this (note 2 is a string):: \t\t\t data:NXdata \t\t\t\t@signal = \"data\" \t\t\t\t@axes = [\"image_id\", \"channel\", \".\", \".\"] \t\t\t\t@image_id_indices = 0 \t\t\t\t@channel_indices = 1 \t\t\t\t@default_slice = [\".\", \"2\", \".\", \".\"] \t\t\t\timage_id = [1, ..., nP] \t\t\t\tchannel = [\"threshold_1\", \"threshold_2\", \"difference\"] \t\t\t\tdata = uint[nP, nC, i, j] \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsample/changer_position" ; rdfs:comment "Sample changer position" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxkappa/entry/sample/rotation_angle" ; rdfs:comment """ This is an array holding the sample rotation angle at each scan point """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXtofraw/entry/MONITOR/preset" ; rdfs:comment "preset value for time or monitor" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/INSTRUMENT/DETECTOR" ; rdfs:comment """ Description of a detector in the instrument. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/SAMPLE/pitch" ; rdfs:comment "Rotation of the sample about the :math:`x` axis (roll)" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NX_PERIOD" ; rdfs:comment """ \t\t\t\tunits of time, period of pulsed source \t\t\t\t(alias to `NX_TIME`) \t\t\t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . nxdetector:trigger_delay_time_set a rdfs:Class ; rdfs:label "NXdetector/trigger_delay_time_set" ; rdfs:comment """ User-specified trigger delay. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdetector_module/fast_pixel_direction/vector" ; rdfs:comment """ \t\t\t\tThree values that define the axis for this transformation \t\t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxrot" ; rdfs:comment """ raw data from a rotation camera, extends :ref:`NXxbase` This is the application definition for raw data from a rotation camera. It extends :ref:`NXxbase`, so the full definition is the content of :ref:`NXxbase` plus the data defined here. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtomophase/entry/control/integral" ; rdfs:comment """ Total integral monitor counts for each measured frame. Allows a correction for fluctuations in the beam between frames. \t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXlauetof/entry/instrument/detector" ; rdfs:comment """ This assumes a planar 2D detector. All angles and distances refer to the center of the detector. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXtofsingle/entry/definition" ; rdfs:comment " Official NeXus NXDL schema to which this file conforms " ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXgeometry/default" ; rdfs:comment """ .. index:: plotting Declares which child group contains a path leading to a :ref:`NXdata` group. It is recommended (as of NIAC2014) to use this attribute to help define the path to the default dataset to be plotted. See https://www.nexusformat.org/2014_How_to_find_default_data.html for a summary of the discussion. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtofsingle/entry/MONITOR/data" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtofnpd" ; rdfs:comment "This is a application definition for raw data from a TOF neutron powder diffractometer" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtofnpd/entry/MONITOR/data" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/overlaps" ; rdfs:comment """ An adjacency list specifying the spatial overlaps of reflections. The adjacency list is specified using an array data type where the elements of the array are the indices of the adjacent overlapped reflection """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXscan/ENTRY/DATA" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtofnpd/entry/MONITOR/time_of_flight" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxnb/entry/name" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdetector/efficiency" ; rdfs:comment "Spectral efficiency of detector with respect to e.g. wavelength" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXbending_magnet/divergence_x_plus" ; rdfs:comment """ Accepted photon beam divergence in X+ (horizontal outboard) direction. Note that divergence_x_plus+divergence_x_minus is the total horizontal beam divergence. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/DETECTOR/threshold_energy" ; rdfs:comment """ Single photon counter detectors can be adjusted for a certain energy range in which they work optimally. This is the energy setting for this. If the detector supports multiple thresholds, this is an array. """ ; rdfs:seeAlso ; rdfs:subClassOf nxdetector:threshold_energy , . a rdfs:Class ; rdfs:label "NXxbase/entry/control/preset" ; rdfs:comment "preset value for time or monitor" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmoderator/default" ; rdfs:comment """ .. index:: plotting Declares which child group contains a path leading to a :ref:`NXdata` group. It is recommended (as of NIAC2014) to use this attribute to help define the path to the default dataset to be plotted. See https://www.nexusformat.org/2014_How_to_find_default_data.html for a summary of the discussion. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXarpes/ENTRY" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/DETECTOR/gain_setting" ; rdfs:comment """ The gain setting of the detector. This influences background. This is a detector-specific value meant to document the gain setting of the detector during data collection, for detectors with multiple available gain settings. Examples of gain settings include: * ``standard`` * ``fast`` * ``auto`` * ``high`` * ``medium`` * ``low`` * ``mixed high to medium`` * ``mixed medium to low`` Developers are encouraged to use one of these terms, or to submit additional terms to add to the list. """ ; rdfs:seeAlso ; rdfs:subClassOf nxdetector:gain_setting , . a rdfs:Class ; rdfs:label "NXtofraw/entry/instrument/detector/distance" ; rdfs:comment "distance to sample for each detector" ; rdfs:seeAlso ; rdfs:subClassOf nxdetector:distance , . a rdfs:Class ; rdfs:label "NXsource/distribution" ; rdfs:comment "The wavelength or energy distribution of the source" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXcrystal/scattering_vector" ; rdfs:comment "Scattering vector, Q, of nominal reflection" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcrystal/cut_angle" ; rdfs:comment "Cut angle of reflecting Bragg plane and plane of crystal surface" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/DATA/Qmean/units" ; rdfs:comment """ Engineering units to use when expressing :math:`Q` and related terms. Data expressed in other units may not be processed by some software packages. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsensor/value_deriv2_log" ; rdfs:comment "Time history of second derivative of sensor readings" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXdata/AXISNAME/first_good" ; rdfs:comment "Index of first good value" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdetector_module/module_offset/offset" ; rdfs:comment """ \t\t\t\tA fixed offset applied before the transformation (three vector components). \t\t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtas/entry/INSTRUMENT/monochromator/rotation_angle" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXinsertion_device/gap" ; rdfs:comment "separation between opposing pairs of magnetic poles" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXinstrument/FERMI_CHOPPER" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXoff_geometry/faces" ; rdfs:comment "The start index in ``winding_order`` for each face." ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdetector/default" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/DETECTOR/beam_center_derived" ; rdfs:comment """ Boolean to indicate if the distance is a derived, rather than a primary observation. If true or not provided, that value of beam_center_derived is assumed to be true. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcollimator/GEOMETRY" ; rdfs:comment "position, shape and size" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXinstrument/EVENT_DATA" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/l" ; rdfs:comment "The l component of the miller index " ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdetector/time_of_flight/axis" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXscan/ENTRY/MONITOR" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsqom/ENTRY" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXsample_component/mass" ; rdfs:comment "Mass of sample component" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxbase/entry/instrument/detector/y_pixel_size" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxeuler/entry/name" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsastof/ENTRY/instrument/source" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXfilter/unit_cell_volume" ; rdfs:comment "Unit cell" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXspe/ENTRY/definition/version" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/DETECTOR/beam_center_x" ; rdfs:comment """ This is the x position where the direct beam would hit the detector. This is a length and can be outside of the actual detector. The length can be in physical units or pixels as documented by the units attribute. Normally, this should be derived from the axis chain, but the direct specification may take precedence if it is not a derived quantity. """ ; rdfs:seeAlso ; rdfs:subClassOf nxdetector:beam_center_x , . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/INSTRUMENT/SOURCE/canSAS_class" ; rdfs:comment "Official canSAS group: :index:`NXcanSAS (applications); SASsource`" ; rdfs:seeAlso ; rdfs:subClassOf . nxdetector:gain_setting a rdfs:Class ; rdfs:label "NXdetector/gain_setting" ; rdfs:comment """ The gain setting of the detector. This is a detector-specific value meant to document the gain setting of the detector during data collection, for detectors with multiple available gain settings. Examples of gain settings include: * ``standard`` * ``fast`` * ``auto`` * ``high`` * ``medium`` * ``low`` * ``mixed high to medium`` * ``mixed medium to low`` Developers are encouraged to use one of these terms, or to submit additional terms to add to the list. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/title" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsubentry/start_time" ; rdfs:comment "Starting time of measurement" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsubentry/thumbnail/mime_type" ; rdfs:comment "The value should be an ``image/*``" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtomo/entry/sample/name" ; rdfs:comment "Descriptive name of sample" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXdetector_channel/threshold_energy" ; rdfs:comment "Energy at which a photon will be recorded" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsastof/ENTRY/instrument/detector/distance" ; rdfs:comment "The distance between detector and sample" ; rdfs:seeAlso ; rdfs:subClassOf nxdetector:distance , . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/DETECTOR/sensor_material" ; rdfs:comment """ At times, radiation is not directly sensed by the detector. Rather, the detector might sense the output from some converter like a scintillator. This is the name of this converter material. """ ; rdfs:seeAlso ; rdfs:subClassOf nxdetector:sensor_material , . a rdfs:Class ; rdfs:label "NXmx/ENTRY/SAMPLE/temperature" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcrystal/density" ; rdfs:comment "mass density of the crystal" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXlog/time/start" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsastof/ENTRY/instrument/detector" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXfilter/unit_cell_alpha" ; rdfs:comment "Unit cell lattice parameter: angle alpha" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmirror/TRANSFORMATIONS" ; rdfs:comment """ This is the group recommended for holding the chain of translation and rotation operations necessary to position the component within the instrument. The dependency chain may however traverse similar groups in other component groups. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXsastof/ENTRY/instrument/detector/beam_center_y" ; rdfs:comment """ \t This is the y position where the direct beam would hit the detector. This is a \t length, not a pixel position, and can be outside of the actual detector. """ ; rdfs:seeAlso ; rdfs:subClassOf nxdetector:beam_center_y , . a rdfs:Class ; rdfs:label "NXreftof/entry/definition" ; rdfs:comment " Official NeXus NXDL schema to which this file conforms " ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXtas/entry/SAMPLE" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/INSTRUMENT/SOURCE/incident_wavelength" ; rdfs:comment "wavelength (:math:`\\lambda`) of radiation incident on the sample" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXattenuator/TRANSFORMATIONS" ; rdfs:comment """ This is the group recommended for holding the chain of translation and rotation operations necessary to position the component within the instrument. The dependency chain may however traverse similar groups in other component groups. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXarchive/entry/release_date" ; rdfs:comment "when this file is to be released into PD" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NX_FLUX" ; rdfs:comment """ \t\t\t\tunits of flux \t\t\t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXshape/shape" ; rdfs:comment "general shape of a component" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXarpes/ENTRY/INSTRUMENT/SOURCE" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtofraw/entry/instrument/detector/detector_number" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcrystal/curvature_horizontal" ; rdfs:comment "Horizontal curvature of focusing crystal" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXarpes/ENTRY/INSTRUMENT/analyser/entrance_slit_setting" ; rdfs:comment "dial setting of the entrance slit" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsample_component/default" ; rdfs:comment """ .. index:: plotting Declares which child group contains a path leading to a :ref:`NXdata` group. It is recommended (as of NIAC2014) to use this attribute to help define the path to the default dataset to be plotted. See https://www.nexusformat.org/2014_How_to_find_default_data.html for a summary of the discussion. """ ; rdfs:seeAlso ; rdfs:subClassOf . nxdetector:x_pixel_size a rdfs:Class ; rdfs:label "NXdetector/x_pixel_size" ; rdfs:comment """ Size of each detector pixel. If it is scalar all pixels are the same size. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/TRANSMISSION_SPECTRUM/T_axes" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmonitor/range" ; rdfs:comment "Range (X-axis, Time-of-flight, etc.) over which the integral was calculated" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXscan/ENTRY/end_time" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NX_ANGLE" ; rdfs:comment """ \t\t\t\tunits of angle \t\t\t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsastof/ENTRY/instrument/detector/aequatorial_angle" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxnb" ; rdfs:comment """ raw data from a single crystal diffractometer, extends :ref:`NXxbase` This is the application definition for raw data from a single crystal diffractometer measuring in normal beam mode. It extends :ref:`NXxbase`, so the full definition is the content of :ref:`NXxbase` plus the data defined here. All angles are logged in order to support arbitrary scans in reciprocal space. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxeuler/entry/instrument/detector/polar_angle" ; rdfs:comment """ The polar_angle (two theta) where the detector is placed at each scan point. """ ; rdfs:seeAlso ; rdfs:subClassOf nxdetector:polar_angle , . a rdfs:Class ; rdfs:label "NXcollimator/blade_spacing" ; rdfs:comment "blade spacing" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtas/entry/definition" ; rdfs:comment " Official NeXus NXDL schema to which this file conforms " ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXtofraw/entry/pre_sample_flightpath" ; rdfs:comment """ This is the flight path before the sample position. This can be determined by a chopper, by the moderator, or the source itself. In other words: it is the distance to the component which gives the T0 signal to the detector electronics. If another component in the NXinstrument hierarchy provides this information, this should be a link. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXsqom/ENTRY/DATA/en" ; rdfs:comment "Values for the energy transfer for each point" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NX_PER_LENGTH" ; rdfs:comment """ \t\t\t\tunits of 1/length \t\t\t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXentry/PROCESS" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdetector/efficiency/wavelength_indices" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsample/stress_field" ; rdfs:comment "Applied external stress field" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXinstrument/GUIDE" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXfermi_chopper/depends_on" ; rdfs:comment """ NeXus positions components by applying a set of translations and rotations to apply to the component starting from 0, 0, 0. The order of these operations is critical and forms what NeXus calls a dependency chain. The depends_on field defines the path to the top most operation of the dependency chain or the string \".\" if located in the origin. Usually these operations are stored in a NXtransformations group. But NeXus allows them to be stored anywhere. .. todo:: Add a definition for the reference point of a fermi chopper. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXarchive/entry/sample/description" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmonopd/entry/INSTRUMENT/CRYSTAL/wavelength" ; rdfs:comment "Optimum diffracted wavelength" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXxas/ENTRY/INSTRUMENT/incoming_beam" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtofraw/entry/instrument/detector/data" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxas/ENTRY/INSTRUMENT" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXfilter/GEOMETRY" ; rdfs:comment "Geometry of the filter" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXsastof/ENTRY" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXmonitor/count_time" ; rdfs:comment """ Elapsed actual counting time, can be an array of size ``np`` when scanning. This is not the difference of the calendar time but the time the instrument was really counting, without pauses or times lost due beam unavailability \t """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxbase/entry/control" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdetector/CHANNELNAME_channel" ; rdfs:comment """ Group containing the description and metadata for a single channel from a multi-channel detector. Given an :ref:`NXdata` group linked as part of an NXdetector group that has an axis with named channels (see the example in :ref:`NXdata `), the NXdetector will have a series of NXdetector_channel groups, one for each channel, named CHANNELNAME_channel. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXcrystal/segment_thickness" ; rdfs:comment "Thickness of individual segment" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXfluo/entry/MONITOR/data" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXattenuator/status" ; rdfs:comment "In or out or moving of the beam" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxbase/entry/control/integral" ; rdfs:comment "Total integral monitor counts" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NX_CURRENT" ; rdfs:comment """ \t\t\t\tunits of electrical current \t\t\t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcollimator/TRANSFORMATIONS" ; rdfs:comment """ This is the group recommended for holding the chain of translation and rotation operations necessary to position the component within the instrument. The dependency chain may however traverse similar groups in other component groups. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NX_WAVENUMBER" ; rdfs:comment """ \t\t\t\tunits of wavenumber or Q \t\t\t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtofsingle/entry/INSTRUMENT/detector/polar_angle" ; rdfs:comment "polar angle for each detector element" ; rdfs:seeAlso ; rdfs:subClassOf nxdetector:polar_angle , . a rdfs:Class ; rdfs:label "NXxbase/entry/sample/temperature" ; rdfs:comment """ The sample temperature or whatever sensor represents this value best """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXgrating/TRANSFORMATIONS" ; rdfs:comment """ \"Engineering\" position of the grating Transformations used by this component to define its position and orientation. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXinstrument/default" ; rdfs:comment """ .. index:: plotting Declares which child group contains a path leading to a :ref:`NXdata` group. It is recommended (as of NIAC2014) to use this attribute to help define the path to the default dataset to be plotted. See https://www.nexusformat.org/2014_How_to_find_default_data.html for a summary of the discussion. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsas/ENTRY/MONITOR/mode" ; rdfs:comment """ Count to a preset value based on either clock time (timer) or received monitor counts (monitor). """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXxrot/entry/sample/rotation_angle" ; rdfs:comment "This is an array holding the sample rotation start angle at each scan point" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXflipper/default" ; rdfs:comment """ .. index:: plotting Declares which child group contains a path leading to a :ref:`NXdata` group. It is recommended (as of NIAC2014) to use this attribute to help define the path to the default dataset to be plotted. See https://www.nexusformat.org/2014_How_to_find_default_data.html for a summary of the discussion. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXentry/revision/comment" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxasproc/ENTRY/entry" ; rdfs:comment """ NeXus convention is to use \"entry1\", \"entry2\", ... for analysis software to locate each entry. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtofsingle/entry/INSTRUMENT/detector/data" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXfilter/default" ; rdfs:comment """ .. index:: plotting Declares which child group contains a path leading to a :ref:`NXdata` group. It is recommended (as of NIAC2014) to use this attribute to help define the path to the default dataset to be plotted. See https://www.nexusformat.org/2014_How_to_find_default_data.html for a summary of the discussion. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXiqproc/ENTRY/DATA/variable" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXinstrument/name/short_name" ; rdfs:comment "short name for instrument, perhaps the acronym" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxbase/entry/sample/x_translation" ; rdfs:comment "Translation of the sample along the X-direction of the laboratory coordinate system" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/INSTRUMENT/DETECTOR/pitch" ; rdfs:comment "Rotation of the detector about the :math:`x` axis (roll)" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsastof/ENTRY/sample/name" ; rdfs:comment "Descriptive name of sample" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXdetector_module/module_offset/transformation_type" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsensor/value_deriv2" ; rdfs:comment """ \t\t\tNominal/average second derivative of value \t\t\t- same dimensions as \"value\" (may be a vector) \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXshape/direction" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtofsingle/entry" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXcollection" ; rdfs:comment """ \t\tAn unvalidated set of terms, such as the description of a beam line. \t\t \t\tUse :ref:`NXcollection` to gather together any set of terms. \t\tThe original suggestion is to use this as a container \t\tclass for the description of a beamline. \t\t \t\tFor NeXus validation, :ref:`NXcollection` will always generate \t\ta warning since it is always an optional group. \t\tAnything (groups, fields, or attributes) placed in \t\tan :ref:`NXcollection` group will not be validated. \t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXbeam/incident_wavelength_spread" ; rdfs:comment """ The wavelength spread FWHM for the corresponding wavelength(s) in incident_wavelength. In the case of shot-to-shot variation in the wavelength spread, this is a 2D array of dimension **nP** by **m** (slow to fast) of the spreads of the corresponding wavelengths in incident_wavelength. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXaperture/default" ; rdfs:comment """ .. index:: plotting Declares which child group contains a path leading to a :ref:`NXdata` group. It is recommended (as of NIAC2014) to use this attribute to help define the path to the default dataset to be plotted. See https://www.nexusformat.org/2014_How_to_find_default_data.html for a summary of the discussion. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxbase/entry/instrument/source/name" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdetector/z_pixel_offset/primary" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXguide/reflectivity/signal" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXcrystal/GEOMETRY" ; rdfs:comment "Position of crystal" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXentry/collection_identifier" ; rdfs:comment "User or Data Acquisition defined group of NeXus files or NXentry" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsubentry/definition/version" ; rdfs:comment "NXDL version number" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdata/scaling_factor" ; rdfs:comment """ \t\t\tThe elements in data are usually float values really. For \t\t\tefficiency reasons these are usually stored as integers \t\t\tafter scaling with a scale factor. This value is the scale \t\t\tfactor. It is required to get the actual physical value, \t\t\twhen necessary. \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsastof/ENTRY/control" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcrystal/shape" ; rdfs:comment "A NXshape group describing the shape of the crystal arrangement" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXaperture/description" ; rdfs:comment "Description of aperture" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmonitor" ; rdfs:comment """ A monitor of incident beam data. It is similar to the :ref:`NXdata` groups containing monitor data and its associated axis coordinates, e.g. time_of_flight or wavelength in pulsed neutron instruments. However, it may also include integrals, or scalar monitor counts, which are often used in both in both pulsed and steady-state instrumentation. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdetector/DETECTOR_MODULE" ; rdfs:comment """ For use in special cases where the data in NXdetector is represented in several parts, each with a separate geometry. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXpositioner/raw_value" ; rdfs:comment "raw value of positioner - need [n] as may be scanned" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/DETECTOR_GROUP/group_parent" ; rdfs:comment """ An array of the hierarchical levels of the parents of detectors or groupings of detectors. A top-level grouping has parent level -1. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/INSTRUMENT/DETECTOR/beam_center_x" ; rdfs:comment """ Position of the beam center on the detector. This is the x position where the direct beam would hit the detector plane. This is a length and can be outside of the actual detector. The length can be in physical units or pixels as documented by the units attribute. The value can be any real number (positive, zero, or negative). """ ; rdfs:seeAlso ; rdfs:subClassOf nxdetector:beam_center_x , . a rdfs:Class ; rdfs:label "NXtas/entry/SAMPLE/sgu" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXarchive/entry/sample/chemical_formula" ; rdfs:comment "Chemical formula formatted according to CIF conventions" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXrefscan/entry/instrument/SOURCE/type" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . nxdetector:raw_time_of_flight a rdfs:Class ; rdfs:label "NXdetector/raw_time_of_flight" ; rdfs:comment "In DAQ clock pulses" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXroot/ENTRY" ; rdfs:comment "entries" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXsubentry/definition/URL" ; rdfs:comment "URL of NXDL file" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreftof/entry/control/data" ; rdfs:comment "Monitor counts in each time channel" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXscan/ENTRY/SAMPLE/rotation_angle" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXbeam_stop/OFF_GEOMETRY" ; rdfs:comment """ This group describes the shape of the beam line component """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXreflections/observed_frame_var/description" ; rdfs:comment "Describes the dataset " ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmonochromator/default" ; rdfs:comment """ .. index:: plotting Declares which child group contains a path leading to a :ref:`NXdata` group. It is recommended (as of NIAC2014) to use this attribute to help define the path to the default dataset to be plotted. See https://www.nexusformat.org/2014_How_to_find_default_data.html for a summary of the discussion. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXroot/h5py_version" ; rdfs:comment "Version of h5py Python package used in writing the file" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsqom/ENTRY/reduction/input" ; rdfs:comment "Input parameters for the reduction program used" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXsas/ENTRY/INSTRUMENT/COLLIMATOR" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXreflections/int_sum" ; rdfs:comment "The estimate of the reflection intensity by summation " ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtofsingle/entry/MONITOR/mode" ; rdfs:comment """ Count to a preset value based on either clock time (timer) or received monitor counts (monitor). """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/DATA/I/units" ; rdfs:comment """ Engineering units to use when expressing :math:`I` and intensity-related terms. Data expressed in other units (or missing a ``@units`` attribute) will be treated as ``arbitrary`` by some software packages. For software using the UDUNITS-2 library, ``arbitrary`` will be changed to ``unknown`` for handling with that library. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXarchive/entry/run_cycle" ; rdfs:comment "TODO: needs documentation" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXscan/ENTRY/INSTRUMENT/DETECTOR/data" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXstxm/ENTRY/DATA/data" ; rdfs:comment """ Detectors that provide more than one value per scan point should be summarised to a single value per scan point for this array in order to simplify plotting. Note that 'Line scans' and focus type scans measure along one spatial dimension but are not restricted to being parallel to the X or Y axes. Such scans should therefore use a single dimension for the positions along the spatial line. The 'sample_x' and 'sample_y' fields should then contain lists of the x- and y-positions and should both have the 'axis' attribute pointing to the same dimension.""" ; rdfs:seeAlso ; rdfs:subClassOf , . nxdetector:countrate_correction_lookup_table a rdfs:Class ; rdfs:label "NXdetector/countrate_correction_lookup_table" ; rdfs:comment """ The countrate_correction_lookup_table defines the LUT used for count-rate correction. It maps a measured count :math:`c` to its corrected value :math:`countrate\\_correction\\_lookup\\_table[c]`. :math:`m` denotes the length of the table. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/BEAM/incident_wavelength_spread" ; rdfs:comment """ The wavelength spread FWHM for the corresponding wavelength(s) in incident_wavelength. In the case of shot-to-shot variation in the wavelength spread, this is a 2D array of dimension **nP** by **m** (slow to fast) of the spreads of the corresponding wavelengths in incident_wavelength. """ ; rdfs:seeAlso ; rdfs:subClassOf , . nxdetector:local_name a rdfs:Class ; rdfs:label "NXdetector/local_name" ; rdfs:comment "Local name for the detector" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXbeam/TRANSFORMATIONS/reference_plane" ; rdfs:comment """ Direction of normal to reference plane used to measure azimuth relative to the beam, its value is ignored. This also defines the parallel and perpendicular components of the beam's polarization. If missing, then the reference plane normal is defined as [0,1,0] and passes through the origin """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXinstrument/POSITIONER" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsastof/ENTRY/instrument/source/type" ; rdfs:comment "type of radiation source" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXfresnel_zone_plate/depends_on" ; rdfs:comment """ NeXus positions components by applying a set of translations and rotations to apply to the component starting from 0, 0, 0. The order of these operations is critical and forms what NeXus calls a dependency chain. The depends_on field defines the path to the top most operation of the dependency chain or the string \".\" if located in the origin. Usually these operations are stored in a NXtransformations group. But NeXus allows them to be stored anywhere. .. todo:: Add a definition for the reference point of a fresnel zone plate. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdetector_channel/flatfield_errors" ; rdfs:comment """ Errors of the flat field correction data. The form flatfield_error is deprecated. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxbase/entry/sample/distance" ; rdfs:comment "Translation of the sample along the Z-direction of the laboratory coordinate system" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXsastof/ENTRY/instrument/detector/polar_angle" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXinstrument/VELOCITY_SELECTOR" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsastof/ENTRY/instrument/detector/data" ; rdfs:comment """ This is area detector data, of number of x-pixel versus number of y-pixels. Since the beam center is to be determined as a step of data reduction, it is not necessary to document or assume the position of the beam center in acquired data. """ ; rdfs:seeAlso ; rdfs:subClassOf nxdetector:data , . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/INSTRUMENT/SOURCE/incident_wavelength_spread" ; rdfs:comment """ Some facilities specify wavelength using a range. This is the width (FWHM) of such a range. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXfilter/TRANSFORMATIONS" ; rdfs:comment """ This is the group recommended for holding the chain of translation and rotation operations necessary to position the component within the instrument. The dependency chain may however traverse similar groups in other component groups. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXcapillary/default" ; rdfs:comment """ .. index:: plotting Declares which child group contains a path leading to a :ref:`NXdata` group. It is recommended (as of NIAC2014) to use this attribute to help define the path to the default dataset to be plotted. See https://www.nexusformat.org/2014_How_to_find_default_data.html for a summary of the discussion. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdata/FIELDNAME_errors" ; rdfs:comment """ \t\t\t\"Errors\" (meaning *uncertainties* or *standard deviations*) \t\t\tassociated with any field named ``FIELDNAME`` in this ``NXdata`` \t\t\tgroup (e.g. an axis, signal or auxiliary signal). \t\t\tThe dimensions of the ``FIELDNAME_errors`` field must match \t\t\tthe dimensions of the ``FIELDNAME`` field. \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXfresnel_zone_plate/support_membrane_material" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmonopd/entry/start_time" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXiqproc/ENTRY/reduction" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXxraylens/lens_thickness" ; rdfs:comment "Thickness of the lens" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NX_QUATERNION" ; rdfs:comment """ \t\t\t\tCompound type representation of quaternion numbers \t\t\t\t(real,i,j,k) in NeXus. \t\t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmirror/bend_angle_x" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxas/ENTRY/INSTRUMENT/SOURCE" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtas/entry/MONITOR/data" ; rdfs:comment "Total integral monitor counts" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/observed_y/description" ; rdfs:comment "Describes the dataset " ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXlog/cue_timestamp_zero" ; rdfs:comment """ \t Timestamps matching the corresponding cue_index into the \t time, value pair. \t """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmirror/external_material" ; rdfs:comment "external material outside substrate" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXarpes/ENTRY/INSTRUMENT/analyser/entrance_slit_size" ; rdfs:comment "size of the entrance slit" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXlauetof/entry/control/data" ; rdfs:comment "use these attributes ``primary=1 signal=1``" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXlauetof/entry/instrument/detector/data/signal" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdisk_chopper/wavelength_range" ; rdfs:comment "Low and high values of wavelength range transmitted" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXstxm/ENTRY/INSTRUMENT/SOURCE/type" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXtas/entry/INSTRUMENT" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXreflections/observed_px_y_errors/description" ; rdfs:comment "Describes the dataset " ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXentry/definition/version" ; rdfs:comment "NXDL version number" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtomophase/entry/instrument/sample/sequence_number" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxbase/entry/sample/name" ; rdfs:comment "Descriptive name of sample" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXentry/program_name/configuration" ; rdfs:comment "configuration of the program" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmoderator/coupled" ; rdfs:comment "whether the moderator is coupled" ; rdfs:seeAlso ; rdfs:subClassOf . nxdetector:frame_time a rdfs:Class ; rdfs:label "NXdetector/frame_time" ; rdfs:comment """ This is time for each frame. This is exposure_time + readout time. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcite/default" ; rdfs:comment """ .. index:: plotting Declares which child group contains a path leading to a :ref:`NXdata` group. It is recommended (as of NIAC2014) to use this attribute to help define the path to the default dataset to be plotted. See https://www.nexusformat.org/2014_How_to_find_default_data.html for a summary of the discussion. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXstxm" ; rdfs:comment """ Application definition for a STXM instrument. The interferometer position measurements, monochromator photon energy values and detector measurements are all treated as NXdetectors and stored within the NXinstrument group as lists of values stored in chronological order. The NXdata group then holds another version of the data in a regular 3D array (NumE by NumY by NumX, for a total of nP points in a sample image stack type scan). The former data values should be stored with a minimum loss of precision, while the latter values can be simplified and/or approximated in order to fit the constraints of a regular 3D array. 'Line scans' and 'point spectra' are just sample_image scan types with reduced dimensions in the same way as single images have reduced E dimensions compared to image 'stacks'. """ ; rdfs:seeAlso ; rdfs:subClassOf . nxdetector:beam_center_x a rdfs:Class ; rdfs:label "NXdetector/beam_center_x" ; rdfs:comment """ This is the x position where the direct beam would hit the detector. This is a length and can be outside of the actual detector. The length can be in physical units or pixels as documented by the units attribute. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtofnpd/entry/MONITOR/preset" ; rdfs:comment "preset value for time or monitor" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxasproc/ENTRY" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXguide/description" ; rdfs:comment "A description of this particular instance of ``NXguide``." ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsource/top_up" ; rdfs:comment "Is the synchrotron operating in top_up mode?" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdata/AXISNAME/last_good" ; rdfs:comment "Index of last good value" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtransformations/default" ; rdfs:comment """ .. index:: plotting Declares which child group contains a path leading to a :ref:`NXdata` group. It is recommended (as of NIAC2014) to use this attribute to help define the path to the default dataset to be plotted. See https://www.nexusformat.org/2014_How_to_find_default_data.html for a summary of the discussion. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/INSTRUMENT/APERTURE/y_gap" ; rdfs:comment "opening along the :math:`y` axis" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmirror/reflectivity" ; rdfs:comment "Reflectivity as function of wavelength" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXfilter/description" ; rdfs:comment """ Composition of the filter. Chemical formula can be specified separately. This field was changed (2010-11-17) from an enumeration to a string since common usage showed a wider variety of use than a simple list. These are the items in the list at the time of the change: Beryllium | Pyrolytic Graphite | Graphite | Sapphire | Silicon | Supermirror. \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxrot/entry/instrument" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXgrating/coating_roughness" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmirror/substrate_thickness" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXpositioner/value" ; rdfs:comment "best known value of positioner - need [n] as may be scanned" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsample_component/unit_cell_class" ; rdfs:comment """ \t\t\tIn case it is all we know and we want to record/document it \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXiqproc/ENTRY/instrument" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXtofraw/entry/user/name" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXentry/INSTRUMENT" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmonopd/entry/MONITOR/preset" ; rdfs:comment "preset value for time or monitor" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcrystal/polar_angle" ; rdfs:comment """ Polar (scattering) angle at which crystal assembly is positioned. Note: some instrument geometries call this term 2theta. Note: it is recommended to use NXtransformations instead. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtomoproc/entry/reconstruction/program" ; rdfs:comment "Name of the program used for reconstruction" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXsas/ENTRY/INSTRUMENT/name" ; rdfs:comment "Name of the instrument actually used to perform the experiment." ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/DETECTOR/DETECTOR_MODULE/slow_pixel_direction/depends_on" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsample/unit_cell_abc" ; rdfs:comment "Crystallography unit cell parameters a, b, and c" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXflipper/type" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtransformations/AXISNAME" ; rdfs:comment """ \t\t\tUnits need to be appropriate for translation or rotation \t\t\tThe name of this field is not forced. The user is free to use any name \t\t\tthat does not cause confusion. When using more than one ``AXISNAME`` field, \t\t\tmake sure that each field name is unique in the same group, as required \t\t\tby HDF5. \t\t\tThe values given should be the start points of exposures for the corresponding \t\t\tframes. The end points should be given in ``AXISNAME_end``. \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxbase/entry/instrument/source/type" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXguide/GEOMETRY" ; rdfs:comment "TODO: Explain what this NXgeometry group means. What is intended here?" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXtomoproc/entry" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXguide/depends_on" ; rdfs:comment """ NeXus positions components by applying a set of translations and rotations to apply to the component starting from 0, 0, 0. The order of these operations is critical and forms what NeXus calls a dependency chain. The depends_on field defines the path to the top most operation of the dependency chain or the string \".\" if located in the origin. Usually these operations are stored in a NXtransformations group. But NeXus allows them to be stored anywhere. The entry opening of the guide lies on the reference plane. The center of the opening on that plane is the reference point on the x and y axis. The reference plane is orthogonal to the z axis and is the reference point along the z axis. Given no bend in the guide, it is parallel with z axis and extends in the positive direction of the z axis. .. image:: guide/guide.png :width: 40% """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXindirecttof/entry/start_time" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NX_LENGTH" ; rdfs:comment """ \t\t\t\tunits of length \t\t\t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/version" ; rdfs:comment """ Describes the version of the canSAS standard used to write this data. This must be a text (not numerical) representation. Such as:: @version=\"1.1\" """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxeuler/entry/sample/chi" ; rdfs:comment """ This is an array holding the chi angle of the eulerian cradle at each scan point """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXgrating/default" ; rdfs:comment """ .. index:: plotting Declares which child group contains a path leading to a :ref:`NXdata` group. It is recommended (as of NIAC2014) to use this attribute to help define the path to the default dataset to be plotted. See https://www.nexusformat.org/2014_How_to_find_default_data.html for a summary of the discussion. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtas/entry/MONITOR" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXrefscan/entry/data" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NX_VOLTAGE" ; rdfs:comment """ \t\t\t\tunits of voltage \t\t\t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/observed_x" ; rdfs:comment """ The estimate of the x position at which the central impact of the reflection was recorded """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXarpes/ENTRY/INSTRUMENT/analyser/energies" ; rdfs:comment """ Energy axis of the analyser data which dimension the axis applies to is defined using the normal NXdata methods. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreftof/entry/data" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/observed_x_var" ; rdfs:comment """ The variance on the estimate of the x position at which the central impact of the reflection was recorded """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXbeam_stop/default" ; rdfs:comment """ .. index:: plotting Declares which child group contains a path leading to a :ref:`NXdata` group. It is recommended (as of NIAC2014) to use this attribute to help define the path to the default dataset to be plotted. See https://www.nexusformat.org/2014_How_to_find_default_data.html for a summary of the discussion. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXnote/file_name" ; rdfs:comment "Name of original file name if note was read from an external source" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXbeam/final_polarization_stokes" ; rdfs:comment """ Polarization vector on leaving beamline component using Stokes notation (see incident_polarization_stokes). """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreftof/entry/title" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxraylens/gas_pressure" ; rdfs:comment "Gas pressure in the lens" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXspe/ENTRY/definition" ; rdfs:comment "Official NeXus NXDL schema to which this file conforms." ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXgrating/substrate_roughness" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcollimator/transmitting_material" ; rdfs:comment "name of transmitting material" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXfilter/substrate_thickness" ; rdfs:comment "substrate thickness of supermirror filter" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcollimator/absorbing_material" ; rdfs:comment "name of absorbing material" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtomoproc/entry/reconstruction/version" ; rdfs:comment "Version of the program used" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXtomoproc/entry/definition" ; rdfs:comment " Official NeXus NXDL schema to which this file conforms " ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXguide/m_value" ; rdfs:comment """ \t The ``m`` value for a supermirror, which defines the supermirror \t regime in multiples of the critical angle of Nickel. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXevent_data/cue_index" ; rdfs:comment """ \t Index into the event_id, event_time_offset pair matching the corresponding \t cue_timestamp. \t """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NX_PULSES" ; rdfs:comment """ \t\t\t\tDEPRECATED: see NX_COUNT \t\t\t\tunits of clock pulses (alias to `NX_NUMBER`) \t\t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/SOURCE/name/short_name" ; rdfs:comment "short name for source, perhaps the acronym" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXtranslation" ; rdfs:comment """ \t\tlegacy class - (used by :ref:`NXgeometry`) - general spatial location of a component. \t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXscan/ENTRY" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/DETECTOR/pixel_mask" ; rdfs:comment """ The 32-bit pixel mask for the detector. Can be either one mask for the whole dataset (i.e. an array with indices i, j) or each frame can have its own mask (in which case it would be an array with indices nP, i, j). Contains a bit field for each pixel to signal dead, blind, high or otherwise unwanted or undesirable pixels. They have the following meaning: * bit 0: gap (pixel with no sensor) * bit 1: dead * bit 2: under-responding * bit 3: over-responding * bit 4: noisy * bit 5: -undefined- * bit 6: pixel is part of a cluster of problematic pixels (bit set in addition to others) * bit 7: -undefined- * bit 8: user defined mask (e.g. around beamstop) * bits 9-30: -undefined- * bit 31: virtual pixel (corner pixel with interpolated value) Normal data analysis software would not take pixels into account when a bit in (mask & 0x0000FFFF) is set. Tag bit in the upper two bytes would indicate special pixel properties that normally would not be a sole reason to reject the intensity value (unless lower bits are set. If the full bit depths is not required, providing a mask with fewer bits is permissible. If needed, additional pixel masks can be specified by including additional entries named pixel_mask_N, where N is an integer. For example, a general bad pixel mask could be specified in pixel_mask that indicates noisy and dead pixels, and an additional pixel mask from experiment-specific shadowing could be specified in pixel_mask_2. The cumulative mask is the bitwise OR of pixel_mask and any pixel_mask_N entries. If provided, it is recommended that it be compressed. """ ; rdfs:seeAlso ; rdfs:subClassOf nxdetector:pixel_mask , . a rdfs:Class ; rdfs:label "NXcylindrical_geometry/detector_number" ; rdfs:comment "Maps cylinders in ``cylinder``, by index, with a detector id." ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdisk_chopper/beam_position" ; rdfs:comment """ \t\t\tAngular separation of the center of the beam and the \t\t\ttop-dead-center timestamp sensor, anticlockwise when facing \t\t\taway from the source. \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXflipper/comp_turns" ; rdfs:comment "Linear density of turns (such as number of turns/cm) in compensating field coils" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXarchive/entry/sample/type" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXarchive/entry/definition" ; rdfs:comment " Official NeXus NXDL schema to which this file conforms " ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXtofraw/entry/duration" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXinstrument/FILTER" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsqom/ENTRY/SAMPLE" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdetector_module/slow_pixel_direction/depends_on" ; rdfs:comment """ \t\t\t\tPoints to the path of the next element in the geometry chain. \t\t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NX_VOLUME" ; rdfs:comment """ \t\t\t\tunits of volume \t\t\t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtofraw/entry/MONITOR/time_of_flight" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsource/emittance_y" ; rdfs:comment "Source emittance (nm-rad) in Y (horizontal) direction." ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdetector_channel/saturation_value" ; rdfs:comment """ The value at which the detector goes into saturation. Especially common to CCD detectors, the data is known to be invalid above this value. For example, given a saturation_value and an underload_value, the valid pixels are those less than or equal to the saturation_value and greater than or equal to the underload_value. The precise type should match the type of the data. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXuser/address" ; rdfs:comment "Address of user" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXarchive/entry/sample" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/SAMPLE/details" ; rdfs:comment "Any additional sample details." ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/default" ; rdfs:comment """ \t\t\t.. index:: plotting \t\t\t \t\t\tDeclares which :ref:`NXdata` group \t\t\tcontains the data to be shown by default. \t\t\tIt is needed to resolve ambiguity when more than one :ref:`NXdata` group exists. \t\t\tThe value is the name of the default :ref:`NXdata` group. \t\t\tUsually, this will be the name of the first *SASdata* group. \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXcollimator/default" ; rdfs:comment """ .. index:: plotting Declares which child group contains a path leading to a :ref:`NXdata` group. It is recommended (as of NIAC2014) to use this attribute to help define the path to the default dataset to be plotted. See https://www.nexusformat.org/2014_How_to_find_default_data.html for a summary of the discussion. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtofraw/entry/SAMPLE/nature" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXfluo/entry/MONITOR/mode" ; rdfs:comment """ Count to a preset value based on either clock time (timer) or received monitor counts (monitor). """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXfluo/entry/INSTRUMENT/SOURCE/name" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsource/default" ; rdfs:comment """ .. index:: plotting Declares which child group contains a path leading to a :ref:`NXdata` group. It is recommended (as of NIAC2014) to use this attribute to help define the path to the default dataset to be plotted. See https://www.nexusformat.org/2014_How_to_find_default_data.html for a summary of the discussion. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXspe/ENTRY/data" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcrystal/segment_columns" ; rdfs:comment "number of segment columns in horizontal direction" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxnb/entry/instrument/detector/polar_angle" ; rdfs:comment """ The polar_angle (gamma) of the detector for each scan point. """ ; rdfs:seeAlso ; rdfs:subClassOf nxdetector:polar_angle , . a rdfs:Class ; rdfs:label "NXiqproc/ENTRY/DATA/qx" ; rdfs:comment "Values for the first dimension of Q" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXuser/facility_user_id" ; rdfs:comment """ \t\t\tfacility based unique identifier for this person \t\t\te.g. their identification code on the facility \t\t\taddress/contact database \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/det_module" ; rdfs:comment "The detector module on which the reflection was recorded " ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXguide" ; rdfs:comment """ A neutron optical element to direct the path of the beam. :ref:`NXguide` is used by neutron instruments to describe a guide consists of several mirrors building a shape through which neutrons can be guided or directed. The simplest such form is box shaped although elliptical guides are gaining in popularity. The individual parts of a guide usually have common characteristics but there are cases where they are different. For example, a neutron guide might consist of 2 or 4 coated walls or a supermirror bender with multiple, coated vanes. To describe polarizing supermirrors such as used in neutron reflection, it may be necessary to revise this definition of :ref:`NXguide` to include :ref:`NXpolarizer` and/or :ref:`NXmirror`. When even greater complexity exists in the definition of what constitutes a *guide*, it has been suggested that :ref:`NXguide` be redefined as a :ref:`NXcollection` of :ref:`NXmirror` each having their own :ref:`NXgeometry` describing their location(s). For the more general case when describing mirrors, consider using :ref:`NXmirror`. NOTE: The NeXus International Advisory Committee welcomes comments for revision and improvement of this definition of :ref:`NXguide`. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXarpes/ENTRY/INSTRUMENT/analyser/angles" ; rdfs:comment """ Angular axis of the analyser data which dimension the axis applies to is defined using the normal NXdata methods. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:comment """ This is the base object of NeXus """ ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdirecttof" ; rdfs:comment "This is a application definition for raw data from a direct geometry TOF spectrometer" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsensor/default" ; rdfs:comment """ .. index:: plotting Declares which child group contains a path leading to a :ref:`NXdata` group. It is recommended (as of NIAC2014) to use this attribute to help define the path to the default dataset to be plotted. See https://www.nexusformat.org/2014_How_to_find_default_data.html for a summary of the discussion. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxbase/entry/instrument" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXbeam/final_beam_divergence" ; rdfs:comment "Divergence FWHM of beam leaving this component" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXstxm/ENTRY/INSTRUMENT/SOURCE/probe" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . nxdetector:underload_value a rdfs:Class ; rdfs:label "NXdetector/underload_value" ; rdfs:comment """ The lowest value at which pixels for this detector would be reasonably measured. The data is known to be invalid below this value. For example, given a saturation_value and an underload_value, the valid pixels are those less than or equal to the saturation_value and greater than or equal to the underload_value. The precise type should match the type of the data. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/INSTRUMENT" ; rdfs:comment """ Description of the small-angle scattering instrument. Consider, carefully, the relevance to the SAS data analysis process when adding subgroups in this **NXinstrument** group. Additional information can be added but will likely be ignored by standardized data anlysis processes. The NeXus :ref:`NXbeam` base class may be added as a subgroup of this **NXinstrument** group *or* as a subgroup of the **NXsample** group to describe properties of the beam at any point downstream from the source. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXxeuler/entry/sample/phi" ; rdfs:comment """ This is an array holding the phi rotation of the eulerian cradle at each scan point """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXfermi_chopper/type" ; rdfs:comment "Fermi chopper type" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/observed_px_x_errors" ; rdfs:comment """ The standard deviation of the estimate of the pixel x position at which the central impact of the reflection was recorded """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmoderator/temperature_log" ; rdfs:comment "log file of moderator temperature" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXorientation/GEOMETRY" ; rdfs:comment "Link to another object if we are using relative positioning, else absent" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXentry/notes" ; rdfs:comment "Notes describing entry" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXxas/ENTRY" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXpositioner" ; rdfs:comment """ A generic positioner such as a motor or piezo-electric transducer. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsubentry/collection_time" ; rdfs:comment """ \t\t\tTime transpired actually collecting data i.e. taking out time when collection was \t\t\tsuspended due to e.g. temperature out of range \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXlauetof/entry/instrument/detector/polar_angle" ; rdfs:comment "The polar_angle (two theta) where the detector is placed." ; rdfs:seeAlso ; rdfs:subClassOf nxdetector:polar_angle , . a rdfs:Class ; rdfs:label "NXstxm/ENTRY/DATA" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsample/thickness" ; rdfs:comment "sample thickness" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/observed_y_errors/description" ; rdfs:comment "Describes the dataset " ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXarpes/ENTRY/title" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . nxdetector:diameter a rdfs:Class ; rdfs:label "NXdetector/diameter" ; rdfs:comment "The diameter of a cylindrical detector" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXstxm/ENTRY/control/data" ; rdfs:comment """ Values to use to normalise for time-variations in photon flux. Typically, the synchrotron storage ring electron beam current is used as a proxy for the X-ray beam intensity. Array must have same shape as the NXdata groups.""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXenvironment/position" ; rdfs:comment """ The position and orientation of the apparatus. Note, it is recommended to use NXtransformations instead. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXinstrument/POLARIZER" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/version" ; rdfs:comment """ Describes the version of the NXmx definition used to write this data. This must be a text (not numerical) representation. Such as:: @version=\"1.0\" """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NX_POSINT" ; rdfs:comment "any representation of a positive integer number (greater than zero)" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxnb/entry/definition" ; rdfs:comment " Official NeXus NXDL schema to which this file conforms " ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXdetector/y_pixel_offset/axis" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdata/DATA" ; rdfs:comment """ \t\t\t.. index:: plotting \t\t\t \t\t\tData values to be used as the NeXus *plottable data*. As the upper case ``DATA`` \t\t\tindicates, the names of the ``DATA`` fields can be chosen :ref:`freely `. The :ref:`signal attribute ` \t\t\tand :ref:`auxiliary_signals attribute` can be used to find all datasets in the ``NXdata`` \t\t\tthat contain data values. \t\t\tThe maximum rank is ``32`` for compatibility with backend file formats. \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtomophase/entry/instrument/bright_field/data" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtomophase/entry" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/DETECTOR/DETECTOR_MODULE/slow_pixel_direction/vector" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/INSTRUMENT/DETECTOR/yaw" ; rdfs:comment "Rotation of the detector about the :math:`y` axis (yaw)" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsas/ENTRY/end_time" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtofraw/entry/start_time" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXevent_data/cue_timestamp_zero/start" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/DETECTOR/DETECTOR_MODULE/fast_pixel_direction/offset" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXlauetof" ; rdfs:comment """ This is the application definition for a TOF laue diffractometer """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/SAMPLE/TRANSFORMATIONS" ; rdfs:comment """ This is the recommended location for sample goniometer and other related axes. This is a requirement to describe for any scan experiment. The reason it is optional is mainly to accommodate XFEL single shot exposures. Use of the depends_on field and the NXtransformations group is strongly recommended. As noted above this should be an absolute requirement to have for any scan experiment. The reason it is optional is mainly to accommodate XFEL single shot exposures. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXvelocity_selector/height" ; rdfs:comment "input beam height" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXguide/incident_angle" ; rdfs:comment "TODO: documentation needed" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsastof/ENTRY/instrument/collimator" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXtofraw/entry/MONITOR" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXlauetof/entry/control" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxeuler/entry/definition" ; rdfs:comment " Official NeXus NXDL schema to which this file conforms " ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXxrot/entry/sample/rotation_angle_step" ; rdfs:comment "This is an array holding the step made for sample rotation angle at each scan point" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtofraw/entry/MONITOR/data" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXaperture/material" ; rdfs:comment "Absorbing material of the aperture" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXspe/ENTRY/INSTRUMENT/name" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmonopd/entry/DATA" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . nxdetector:serial_number a rdfs:Class ; rdfs:label "NXdetector/serial_number" ; rdfs:comment "Serial number for the detector" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXguide/bend_angle_x" ; rdfs:comment "TODO: documentation needed" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsubentry/USER" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXgeometry/TRANSLATION" ; rdfs:comment "translation of component" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXgrating/depth" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmonopd/entry/INSTRUMENT/SOURCE" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXstxm/ENTRY/DATA/stxm_scan_type" ; rdfs:comment """ Label for typical scan types as a convenience for humans. Each label corresponds to a specific set of axes being scanned to produce a data array of shape: * sample point spectrum: (photon_energy,) * sample line spectrum: (photon_energy, sample_y/sample_x) * sample image: (sample_y, sample_x) * sample image stack: (photon_energy, sample_y, sample_x) * sample focus: (zoneplate_z, sample_y/sample_x) * osa image: (osa_y, osa_x) * osa focus: (zoneplate_z, osa_y/osa_x) * detector image: (detector_y, detector_x) The \"generic scan\" string is to be used when none of the other choices are appropriate. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/definition" ; rdfs:comment " NeXus NXDL schema to which this file conforms " ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/INSTRUMENT/COLLIMATOR/length" ; rdfs:comment "Amount/length of collimation inserted (as on a SANS instrument)" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXslit/TRANSFORMATIONS" ; rdfs:comment """ This is the group recommended for holding the chain of translation and rotation operations necessary to position the component within the instrument. The dependency chain may however traverse similar groups in other component groups. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXsource/target_material" ; rdfs:comment "Pulsed source target material" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtofsingle/entry/user/name" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXpinhole/TRANSFORMATIONS" ; rdfs:comment """ This is the group recommended for holding the chain of translation and rotation operations necessary to position the component within the instrument. The dependency chain may however traverse similar groups in other component groups. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXsqom/ENTRY/DATA/data" ; rdfs:comment " This is the intensity for each point in QE " ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtomophase/entry/instrument/dark_field" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsas/ENTRY/INSTRUMENT/DETECTOR/rotation_angle" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxlaue/entry/definition" ; rdfs:comment " Official NeXus NXDL schema to which this file conforms " ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXguide/reflectivity/wavelength_indices" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . nxdetector:flatfield a rdfs:Class ; rdfs:label "NXdetector/flatfield" ; rdfs:comment "Flat field correction data." ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdetector_module/data_origin" ; rdfs:comment """ \t\t\tA dimension-2 or dimension-3 field which gives the indices \t\t\tof the origin of the hyperslab of data for this module in the \t\t\tmain area detector image in the parent NXdetector module. \t\t\tThe data_origin is 0-based. \t\t\tThe frame number dimension (np) is omitted. Thus the \t\t\tdata_origin field for a dimension-2 dataset with indices (np, i, j) \t\t\twill be an array with indices (i, j), and for a dimension-3 \t\t\tdataset with indices (np, i, j, k) will be an array with indices \t\t\t(i, j, k). \t\t\tThe :ref:`order ` of indices (i, j or i, j, k) is slow to fast. \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . nxdetector:count_time a rdfs:Class ; rdfs:label "NXdetector/count_time" ; rdfs:comment "Elapsed actual counting time" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsource/last_fill" ; rdfs:comment "For storage rings, the current at the end of the most recent injection." ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdetector/z_pixel_offset/long_name" ; rdfs:comment "y-axis offset from detector center" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXlog/cue_index" ; rdfs:comment """ \t Index into the time, value pair matching the corresponding \t cue_timestamp_zero. \t """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmonopd/entry/INSTRUMENT/DETECTOR/data" ; rdfs:comment """ detector signal (usually counts) are already corrected for detector efficiency """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXflipper/flip_current" ; rdfs:comment "Flipping field coil current in \"on\" state\"" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXinsertion_device/OFF_GEOMETRY" ; rdfs:comment """ This group describes the shape of the beam line component """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXmx/ENTRY" ; rdfs:comment """ Note, it is recommended that ``file_name`` and ``file_time`` are included as attributes at the root of a file that includes :ref:`NXmx`. See :ref:`NXroot`. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXxraylens/OFF_GEOMETRY" ; rdfs:comment """ This group describes the shape of the beam line component """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXfermi_chopper/GEOMETRY" ; rdfs:comment "geometry of the fermi chopper" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXlauetof/entry/instrument/detector/azimuthal_angle" ; rdfs:comment "The azimuthal angle where the detector is placed." ; rdfs:seeAlso ; rdfs:subClassOf nxdetector:azimuthal_angle , . a rdfs:Class ; rdfs:label "NXxbase/entry/instrument/detector" ; rdfs:comment """ The name of the group is detector if there is only one detector, if there are several, names have to be detector1, detector2, ...detectorn.""" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXentry/default" ; rdfs:comment """ \t\t\t.. index:: find the default plottable data \t\t\t.. index:: plotting \t\t\t.. index:: default attribute value \t\t\tDeclares which :ref:`NXdata` group contains the data \t\t\tto be shown by default. \t\t\tIt is used to resolve ambiguity when \t\t\tone :ref:`NXdata` group exists. \t\t\tThe value :ref:`names ` a child group. If that group \t\t\titself has a ``default`` attribute, continue this chain until an \t\t\t:ref:`NXdata` group is reached. \t\t\tFor more information about how NeXus identifies the default \t\t\tplottable data, see the \t\t\t:ref:`Find Plottable Data, v3 ` \t\t\tsection. \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcrystal/wavelength" ; rdfs:comment "Optimum diffracted wavelength" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/l/description" ; rdfs:comment "Describes the dataset " ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXbeam/incident_beam_divergence" ; rdfs:comment """ Beam crossfire in degrees parallel to the laboratory X axis The dimension **c** is a series of moments of that represent the standard uncertainty (e.s.d.) of the directions of of the beam. The first and second moments are in the XZ and YZ planes around the mean source beam direction, respectively. Further moments in **c** characterize co-variance terms, so the next moment is the product of the first two, and so on. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsubentry/definition" ; rdfs:comment "Official NeXus NXDL schema to which this subentry conforms" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/observed_phi" ; rdfs:comment """ The estimate of the phi angle at which the central impact of the reflection was recorded """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsource/notes" ; rdfs:comment """ \t\t\tany source/facility related messages/events that \t\t\toccurred during the experiment \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXinstrument/name" ; rdfs:comment "Name of instrument" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXlauetof/entry/instrument/detector/x_pixel_size" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXlauetof/entry/instrument" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/INSTRUMENT/SOURCE/beam_size_x" ; rdfs:comment "Size of the incident beam along the x axis." ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXrefscan/entry/title" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXarpes" ; rdfs:comment """ This is an application definition for angular resolved photo electron spectroscopy. It has been drawn up with hemispherical electron analysers in mind. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcollimator" ; rdfs:comment "A beamline collimator." ; rdfs:seeAlso ; rdfs:subClassOf . nxdetector:pixel_mask a rdfs:Class ; rdfs:label "NXdetector/pixel_mask" ; rdfs:comment """ The 32-bit pixel mask for the detector. Can be either one mask for the whole dataset (i.e. an array with indices i, j) or each frame can have its own mask (in which case it would be an array with indices np, i, j). Contains a bit field for each pixel to signal dead, blind or high or otherwise unwanted or undesirable pixels. They have the following meaning: .. can't make a table here, a bullet list will have to do for now * bit 0: gap (pixel with no sensor) * bit 1: dead * bit 2: under responding * bit 3: over responding * bit 4: noisy * bit 5: -undefined- * bit 6: pixel is part of a cluster of problematic pixels (bit set in addition to others) * bit 7: -undefined- * bit 8: user defined mask (e.g. around beamstop) * bits 9-30: -undefined- * bit 31: virtual pixel (corner pixel with interpolated value) Normal data analysis software would not take pixels into account when a bit in (mask & 0x0000FFFF) is set. Tag bit in the upper two bytes would indicate special pixel properties that normally would not be a sole reason to reject the intensity value (unless lower bits are set. If the full bit depths is not required, providing a mask with fewer bits is permissible. If needed, additional pixel masks can be specified by including additional entries named pixel_mask_N, where N is an integer. For example, a general bad pixel mask could be specified in pixel_mask that indicates noisy and dead pixels, and an additional pixel mask from experiment-specific shadowing could be specified in pixel_mask_2. The cumulative mask is the bitwise OR of pixel_mask and any pixel_mask_N entries. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmonopd/entry/INSTRUMENT/CRYSTAL" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NX_DIMENSIONLESS" ; rdfs:comment """ \t\t\t\tunits for fields where the units cancel out \t\t\t\t(NOTE: not the same as NX_UNITLESS) \t\t\t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmonopd/entry/MONITOR" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/INSTRUMENT/APERTURE/shape" ; rdfs:comment """ describe the type of aperture (pinhole, 4-blade slit, Soller slit, ...) """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxbase/entry/instrument/source" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/DATA/dQl/units" ; rdfs:comment """ Engineering units to use when expressing :math:`Q` and related terms. Data expressed in other units may not be processed by some software packages. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/DATA/Q/resolutions" ; rdfs:comment """ .. index:: NXcanSAS (applications); resolutions (optional: for numerical arrays) Names the dataset (in this SASdata group) containing the :math:`Q` resolution. The name of the dataset containing the :math:`Q` resolution is flexible. The name must be unique in the *SASdata* group. .. comment see: https://github.com/canSAS-org/canSAS2012/issues/7 The *resolutions* field will have the same *shape* (dimensions) as the Q field. Generally, this is the principal resolution of each :math:`Q`. Names the data object (in this SASdata group) that provides the :math:`Q` resolution to be used for data analysis. Such as:: @resolutions=\"Qdev\" To specify two-dimensional resolution for slit-smearing geometry, such as (*dQw*, *dQl*), use a string array, such as:: @resolutions=\"dQw\", \"dQl\" There may also be a subdirectory (optional) with constituent components. This pattern will demonstrate how to introduce further as-yet unanticipated terms related to the data. .. comment see: https://github.com/nexusformat/definitions/issues/492#issuecomment-262813907 By default, the values of the resolutions data object are assumed to be one standard deviation of any function used to approximate the resolution function. This equates to the width of the gaussian distribution if a Gaussian is chosen. See the ``@resolutions_description`` attribute. .. note:: To report uncertainty in reported :math:`Q` values, use the ``@uncertainties`` attribute. It is possible for both ``@resolutions`` and ``uncertainties`` to be reported. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtofsingle/entry/INSTRUMENT/detector" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/partiality" ; rdfs:comment """ The partiality of the reflection. Dividing by this number will inflate the measured intensity to the full reflection equivalent. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXspe/ENTRY/SAMPLE/seblock" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/DETECTOR/TRANSFORMATIONS" ; rdfs:comment """ Location for axes (transformations) to do with the detector. In the case of a single-module detector, the axes of the detector axis chain may be stored here. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/DETECTOR/sensor_thickness" ; rdfs:comment """ At times, radiation is not directly sensed by the detector. Rather, the detector might sense the output from some converter like a scintillator. This is the thickness of this converter material. """ ; rdfs:seeAlso ; rdfs:subClassOf nxdetector:sensor_thickness , . a rdfs:Class ; rdfs:label "NXtomophase/entry/instrument/sample/distance" ; rdfs:comment "Distance between detector and sample" ; rdfs:seeAlso ; rdfs:subClassOf nxdetector:distance , . a rdfs:Class ; rdfs:label "NXtomophase/entry/sample/rotation_angle" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdetector/raw_time_of_flight/frequency" ; rdfs:comment "Clock frequency in Hz" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/DETECTOR/distance_derived" ; rdfs:comment """ Boolean to indicate if the distance is a derived, rather than a primary observation. If distance_derived true or is not specified, the distance is assumed to be derived from detector axis specifications. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdirecttof/entry/INSTRUMENT/fermi_chopper" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtas/entry/SAMPLE/unit_cell" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtas/entry/SAMPLE/name" ; rdfs:comment "Descriptive name of sample" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXentry/definition_local" ; rdfs:comment """ \t\t\tLocal NXDL schema extended from the entry \t\t\tspecified in the ``definition`` field. \t\t\tThis contains any locally-defined, \t\t\tadditional fields in the entry. \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtofsingle/entry/INSTRUMENT/detector/distance" ; rdfs:comment "Distance to sample for the center of the detector" ; rdfs:seeAlso ; rdfs:subClassOf nxdetector:distance , . a rdfs:Class ; rdfs:label "NXmx/ENTRY/DATA/data" ; rdfs:comment """ For a dimension-2 detector, the rank of the data array will be 3. For a dimension-3 detector, the rank of the data array will be 4. This allows for the introduction of the frame number as the first index. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXarchive/entry/sample/magnetic_field" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXdirecttof/entry/INSTRUMENT/disk_chopper" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXentry/program_name" ; rdfs:comment "Name of program used to generate this file" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/SAMPLE" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXsample_component/sample_orientation" ; rdfs:comment "This will follow the Busing and Levy convention from Acta.Crysta v22, p457 (1967)" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NX_FLOAT" ; rdfs:comment "any representation of a floating point number" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreftof/entry/instrument/detector/x_pixel_size" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/DATA/I/scaling_factor" ; rdfs:comment """ (optional) Names the field (a.k.a. dataset) that contains a factor to multiply ``I``. By default, this value is unity. Should an uncertainty be associated with the scaling factor field, the field containing that uncertainty would be designated via the ``uncertainties`` attribute. Such as:: I : NX_NUMBER @uncertainties=\"Idev\" : NX_CHAR @scaling_factor=\"I_scaling\" : NX_CHAR Idev : NX_NUMBER I_scaling : NX_NUMBER @uncertainties=\"I_scaling_dev\" : NX_CHAR I_scaling_dev : NX_NUMBER The exact names for ``I_scaling`` and ``I_scaling_dev`` are not defined by NXcanSAS. The user has the flexibility to use names different than those shown in this example. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxasproc/ENTRY/DATA/data" ; rdfs:comment """ This is corrected and calibrated I(incoming)/I(absorbed). So it is the absorption. Expect attribute ``signal=1`` """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsas" ; rdfs:comment """ Raw, monochromatic 2-D SAS data with an area detector. This is an application definition for raw data (not processed or reduced data) from a 2-D small angle scattering instrument collected with a monochromatic beam and an area detector. It is meant to be suitable both for neutron SANS and X-ray SAXS data. It covers all raw data from any monochromatic SAS techniques that use an area detector: SAS, WSAS, grazing incidence, GISAS It covers all raw data from any SAS techniques that use an area detector and a monochromatic beam. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NX_MASS" ; rdfs:comment """ \t\t\t\tunits of mass \t\t\t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdata/title" ; rdfs:comment """ \t\t\tTitle for the plot. \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXpositioner/default" ; rdfs:comment """ .. index:: plotting Declares which child group contains a path leading to a :ref:`NXdata` group. It is recommended (as of NIAC2014) to use this attribute to help define the path to the default dataset to be plotted. See https://www.nexusformat.org/2014_How_to_find_default_data.html for a summary of the discussion. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmoderator/pulse_shape" ; rdfs:comment "moderator pulse shape" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXsensor/OFF_GEOMETRY" ; rdfs:comment """ This group describes the shape of the sensor when necessary. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXmonitor/start_time" ; rdfs:comment "Starting time of measurement" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXlauetof/entry/control/time_of_flight" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsqom/ENTRY/DATA/qz" ; rdfs:comment "Positions for the the third dimension of Q" ; rdfs:seeAlso ; rdfs:subClassOf . nxdetector:angular_calibration_applied a rdfs:Class ; rdfs:label "NXdetector/angular_calibration_applied" ; rdfs:comment """ True when the angular calibration has been applied in the electronics, false otherwise. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtomo/entry/instrument/detector/x_rotation_axis_pixel_position" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcrystal/mosaic_vertical" ; rdfs:comment "vertical mosaic Full Width Half Maximum" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/h" ; rdfs:comment "The h component of the miller index " ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtofraw/entry/MONITOR/mode" ; rdfs:comment """ Count to a preset value based on either clock time (timer) or received monitor counts (monitor). """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/SAMPLE/temperature" ; rdfs:comment "Temperature of this sample." ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsas/ENTRY/INSTRUMENT/SOURCE/probe" ; rdfs:comment """ Name of radiation probe, necessary to compute the sample contrast. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXreflections/k" ; rdfs:comment "The k component of the miller index " ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/DETECTOR/DETECTOR_MODULE/slow_pixel_direction/transformation_type" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXlog/description" ; rdfs:comment "Description of logged value" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsas/ENTRY/INSTRUMENT/DETECTOR/y_pixel_size" ; rdfs:comment "Physical size of a pixel in y-direction." ; rdfs:seeAlso ; rdfs:subClassOf nxdetector:y_pixel_size , . a rdfs:Class ; rdfs:label "NXtomophase/entry/instrument/sample/x_pixel_size" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsastof/ENTRY/instrument/source/probe" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . nxdetector:sequence_number a rdfs:Class ; rdfs:label "NXdetector/sequence_number" ; rdfs:comment """ In order to properly sort the order of the images taken in (for example) a tomography experiment, a sequence number is stored with each image. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsource/distance" ; rdfs:comment """ \t\t\tEffective distance from sample \t\t\tDistance as seen by radiation from sample. This number should be negative \t\t\tto signify that it is upstream of the sample. \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXarpes/ENTRY/INSTRUMENT/analyser" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsample_component/orientation_matrix" ; rdfs:comment """ \t\t\tOrientation matrix of single crystal sample component. \t\t\tThis will follow the Busing and Levy convention from Acta.Crysta v22, p457 (1967) \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXentry/pre_sample_flightpath" ; rdfs:comment """ \t\t\tThis is the flightpath before the sample position. This can be determined by a chopper, \t\t\tby the moderator or the source itself. In other words: it the distance to the component \t\t\twhich gives the T0 signal to the detector electronics. If another component in the \t\t\tNXinstrument hierarchy provides this information, this should be a link. \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdetector_channel/flatfield" ; rdfs:comment "Response of each pixel given a constant input" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsample_component/chemical_formula" ; rdfs:comment """ \t\t\tThe chemical formula specified using CIF conventions. \t\t\tAbbreviated version of CIF standard: \t\t\t \t\t\t* Only recognized element symbols may be used. \t\t\t* Each element symbol is followed by a 'count' number. A count of '1' may be omitted. \t\t\t* A space or parenthesis must separate each cluster of (element symbol + count). \t\t\t* Where a group of elements is enclosed in parentheses, the multiplier for the \t\t\t group must follow the closing parentheses. That is, all element and group \t\t\t multipliers are assumed to be printed as subscripted numbers. \t\t\t* Unless the elements are ordered in a manner that corresponds to their chemical \t\t\t structure, the order of the elements within any group or moiety depends on \t\t\t whether or not carbon is present. \t\t\t* If carbon is present, the order should be: \t\t\t \t\t\t - C, then H, then the other elements in alphabetical order of their symbol. \t\t\t - If carbon is not present, the elements are listed purely in alphabetic order of their symbol. \t\t\t \t\t\t* This is the *Hill* system used by Chemical Abstracts. \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXlog/raw_value" ; rdfs:comment "Array of raw information, such as thermocouple voltage" ; rdfs:seeAlso ; rdfs:subClassOf . nxdetector:layout a rdfs:Class ; rdfs:label "NXdetector/layout" ; rdfs:comment "How the detector is represented" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/DETECTOR/DETECTOR_MODULE/fast_pixel_direction/vector" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXspe/ENTRY/SAMPLE/rotation_angle" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcrystal/orientation_matrix" ; rdfs:comment """ \tOrientation matrix of single crystal sample using Busing-Levy convention: \tW. R. Busing and H. A. Levy (1967). Acta Cryst. 22, 457-464 """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/SAMPLE/depends_on" ; rdfs:comment """ This is a requirement to describe for any scan experiment. The axis on which the sample position depends may be stored anywhere, but is normally stored in the NXtransformations group within the NXsample group. If there is no goniometer, e.g. with a jet, depends_on should be set to \".\" """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXsample/magnetic_field/direction" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxlaue/entry/instrument/source" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXxas/ENTRY/DATA" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtransformations/AXISNAME_end" ; rdfs:comment """ \t\t\t``AXISNAME_end`` is a placeholder for a name constructed from the actual \t\t\tname of an axis to which ``_end`` has been appended. \t\t\tThe values in this field are the end points of the motions that start \t\t\tat the corresponding positions given in the ``AXISNAME`` field. \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsas/ENTRY/title" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/DATA/dQl" ; rdfs:comment """ .. index:: NXcanSAS (applications); dQl :math:`Q` **resolution** perpendicular to the axis of scanning (the low-resolution *slit length* direction). Useful for defining resolution data from slit-smearing instruments such as Bonse-Hart geometry. Must have the same units as :math:`Q`. When present, the name of this field is also recorded in the *resolutions* attribute of *Q*, as in:: Q/@resolutions=\"dQw\", \"dQl\" """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/observed_px_x/description" ; rdfs:comment "Describes the dataset " ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/run/name" ; rdfs:comment """ Optional string attribute to identify this particular *run*. Could use this to associate (correlate) multiple *SASdata* elements with *run* elements. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXentry/experiment_description" ; rdfs:comment "Brief summary of the experiment, including key objectives." ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXarchive/entry/title" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtofraw/entry/MONITOR/distance" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsample/TRANSFORMATIONS" ; rdfs:comment """ This is the group recommended for holding the chain of translation and rotation operations necessary to position the component within the instrument. The dependency chain may however traverse similar groups in other component groups. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXinsertion_device/power" ; rdfs:comment "total power delivered by insertion device" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXpositioner/name" ; rdfs:comment "symbolic or mnemonic name (one word)" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtomophase/entry/sample/x_translation" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsource/bunch_pattern" ; rdfs:comment """ \t\t\tFor storage rings, description of the bunch pattern. \t\t\tThis is useful to describe irregular bunch patterns. \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/DETECTOR/DETECTOR_MODULE/fast_pixel_direction/transformation_type" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/DATA/Qmean" ; rdfs:comment """ Mean value of :math:`Q` for this data point. Useful when describing data that has been binned from higher-resolution data. It is expected that ``Q`` is provided and that both ``Q`` and ``Qmean`` will have the same units. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXbeam/TRANSFORMATIONS" ; rdfs:comment """ Direction (and location) for the beam. The location of the beam can be given by any point which it passes through as its offset attribute. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXdata/AXISNAME/axis" ; rdfs:comment """ \t\t\t\tIndex (positive integer) identifying this specific set of numbers. \t\t\t\t \t\t\t\tN.B. The ``axis`` attribute is the old way of designating a link. \t\t\t\tDo not use the :ref:`axes ` attribute with the ``axis`` attribute. \t\t\t\tThe :ref:`axes ` attribute is now preferred. \t\t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtomophase/entry/end_time" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXbeam/incident_energy" ; rdfs:comment "Energy carried by each particle of the beam on entering the beamline component" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtofraw/entry/definition" ; rdfs:comment " Official NeXus NXDL schema to which this file conforms " ; rdfs:seeAlso ; rdfs:subClassOf , . nxdetector:data_errors a rdfs:Class ; rdfs:label "NXdetector/data_errors" ; rdfs:comment """ The best estimate of the uncertainty in the data value (array size should match the data field). Where possible, this should be the standard deviation, which has the same units as the data. The form data_error is deprecated. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/predicted_y/description" ; rdfs:comment "Describes the dataset " ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXiqproc/ENTRY/reduction/output" ; rdfs:comment "Eventual output parameters from the data reduction program used" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXreflections/polar_angle/description" ; rdfs:comment "Describes the dataset " ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NX_BOOLEAN" ; rdfs:comment "true/false value ( true | 1 | false | 0 )" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/end_time" ; rdfs:comment """ ISO 8601 time/date of the last data point collected in UTC, using the Z suffix to avoid confusion with local time. Note that the time zone of the beamline should be provided in NXentry/NXinstrument/time_zone. This field should only be filled when the value is accurately observed. If the data collection aborts or otherwise prevents accurate recording of the end_time, this field should be omitted. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/DETECTOR/saturation_value" ; rdfs:comment """ The value at which the detector goes into saturation. Data above this value is known to be invalid. For example, given a saturation_value and an underload_value, the valid pixels are those less than or equal to the saturation_value and greater than or equal to the underload_value. """ ; rdfs:seeAlso ; rdfs:subClassOf nxdetector:saturation_value , . a rdfs:Class ; rdfs:label "NXguide/substrate_material" ; rdfs:comment "TODO: documentation needed" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcapillary/manufacturer" ; rdfs:comment """ The manufacturer of the capillary. This is actually important as it may have an impact on performance. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsas/ENTRY/DATA/signal" ; rdfs:comment """ Name the *plottable* field. The link here defines this name as ``data``. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXtofsingle/entry/start_time" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXbending_magnet/default" ; rdfs:comment """ .. index:: plotting Declares which child group contains a path leading to a :ref:`NXdata` group. It is recommended (as of NIAC2014) to use this attribute to help define the path to the default dataset to be plotted. See https://www.nexusformat.org/2014_How_to_find_default_data.html for a summary of the discussion. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdetector/efficiency/signal" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXreflections/int_sum_var/description" ; rdfs:comment "Describes the dataset " ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXspe/ENTRY" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/DATA/Q/uncertainties" ; rdfs:comment """ (optional: for numerical arrays) Names the dataset (in this SASdata group) that provides the uncertainty to be used for data analysis. The name of the dataset containing the :math:`Q` uncertainty is flexible. The name must be unique in the *SASdata* group. .. comment see: https://github.com/canSAS-org/canSAS2012/issues/7 Such as:: @uncertainties=\"Q_uncertainties\" The *uncertainties* field will have the same *shape* (dimensions) as the Q field. These values are the estimates of uncertainty of each Q. By default, this will be interpreted to be the estimated standard deviation. In special cases, when a standard deviation cannot possibly be used, its value can specify another measure of distribution width. There may also be a subdirectory (optional) with constituent components. .. note:: To report distribution in reported :math:`Q` values, use the ``@resolutions`` attribute. It is possible for both ``@resolutions`` and ``uncertainties`` to be reported. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/DETECTOR/data" ; rdfs:comment """ For a dimension-2 detector, the rank of the data array will be 3. For a dimension-3 detector, the rank of the data array will be 4. This allows for the introduction of the frame number as the first index. """ ; rdfs:seeAlso ; rdfs:subClassOf nxdetector:data , . a rdfs:Class ; rdfs:label "NXfluo/entry/INSTRUMENT/monochromator/wavelength" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXxnb/entry/sample" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXinsertion_device/spectrum" ; rdfs:comment "spectrum of insertion device" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXnote/description" ; rdfs:comment "Title of an image or other details of the note" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/DETECTOR/bit_depth_readout" ; rdfs:comment """ How many bits the electronics record per pixel. """ ; rdfs:seeAlso ; rdfs:subClassOf nxdetector:bit_depth_readout , . a rdfs:Class ; rdfs:label "NXentry/COLLECTION" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsubentry/run_cycle" ; rdfs:comment "Such as \"2007-3\". Some user facilities organize their beam time into run cycles." ; rdfs:seeAlso ; rdfs:subClassOf . nxdetector:type a rdfs:Class ; rdfs:label "NXdetector/type" ; rdfs:comment """ Description of type such as He3 gas cylinder, He3 PSD, scintillator, fission chamber, proportion counter, ion chamber, ccd, pixel, image plate, CMOS, ... """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXparameters/default" ; rdfs:comment """ .. index:: plotting Declares which child group contains a path leading to a :ref:`NXdata` group. It is recommended (as of NIAC2014) to use this attribute to help define the path to the default dataset to be plotted. See https://www.nexusformat.org/2014_How_to_find_default_data.html for a summary of the discussion. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/DETECTOR/underload_value" ; rdfs:comment """ The lowest value at which pixels for this detector would be reasonably be measured. For example, given a saturation_value and an underload_value, the valid pixels are those less than or equal to the saturation_value and greater than or equal to the underload_value. """ ; rdfs:seeAlso ; rdfs:subClassOf nxdetector:underload_value , . a rdfs:Class ; rdfs:label "NXpolarizer/default" ; rdfs:comment """ .. index:: plotting Declares which child group contains a path leading to a :ref:`NXdata` group. It is recommended (as of NIAC2014) to use this attribute to help define the path to the default dataset to be plotted. See https://www.nexusformat.org/2014_How_to_find_default_data.html for a summary of the discussion. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXlauetof/entry/instrument/detector/time_of_flight" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXlog/duration" ; rdfs:comment "Total time log was taken" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXiqproc/ENTRY/entry" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtomo/entry/instrument/SOURCE" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/DETECTOR/DETECTOR_MODULE/module_offset" ; rdfs:comment """ Offset of the module in regards to the origin of the detector in an arbitrary direction. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXtomo/entry/instrument/SOURCE/probe" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXsqom/ENTRY/definition" ; rdfs:comment " Official NeXus NXDL schema to which this file conforms " ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXmoderator/poison_depth" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtofnpd/entry/INSTRUMENT/detector/polar_angle" ; rdfs:comment "polar angle for each detector element" ; rdfs:seeAlso ; rdfs:subClassOf nxdetector:polar_angle , . a rdfs:Class ; rdfs:label "NXiqproc/ENTRY/reduction/input/filenames" ; rdfs:comment "Raw data files used to generate this I(Q)" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmonitor/OFF_GEOMETRY" ; rdfs:comment """ This group describes the shape of the beam line component """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXmonopd/entry/title" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXentry/duration" ; rdfs:comment "Duration of measurement" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtofraw/entry/title" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXbeam_stop/CYLINDRICAL_GEOMETRY" ; rdfs:comment """ This group is an alternative to NXoff_geometry for describing the shape of the beam stop. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXxkappa/entry/name" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsastof/ENTRY/sample/aequatorial_angle" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXoff_geometry/vertices" ; rdfs:comment """ List of x,y,z coordinates for vertices. The origin of the coordinates is the position of the parent component, for example the NXdetector which the geometry describes. If the shape describes a single pixel for a detector with uniform pixel shape then the origin is the position of each pixel as described by the ``x/y/z_pixel_offset`` datasets in ``NXdetector``. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXbeam/incident_polarization_stokes" ; rdfs:comment """ Polarization vector on entering beamline component using Stokes notation The Stokes parameters are four components labelled I,Q,U,V or S_0,S_1,S_2,S_3. These are defined with the standard Nexus coordinate frame unless it is overridden by an NXtransformations field pointed to by a depends_on attribute. The last component, describing the circular polarization state, is positive for a right-hand circular state - that is the electric field vector rotates clockwise at the sample and over time when observed from the source. I (S_0) is the beam intensity (often normalized to 1). Q, U, and V scale linearly with the total degree of polarization, and indicate the relative magnitudes of the pure linear and circular orientation contributions. Q (S_1) is linearly polarized along the x axis (Q > 0) or y axis (Q < 0). U (S_2) is linearly polarized along the x==y axis (U > 0) or the -x==y axis (U < 0). V (S_3) is circularly polarized. V > 0 when the electric field vector rotates clockwise at the sample with respect to time when observed from the source; V < 0 indicates the opposite rotation. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/INSTRUMENT/SOURCE/beam_shape" ; rdfs:comment "Text description of the shape of the beam (incident on the sample)." ; rdfs:seeAlso ; rdfs:subClassOf . nxdetector:stop_time a rdfs:Class ; rdfs:label "NXdetector/stop_time" ; rdfs:comment "stop time for each frame, with the ``start`` attribute as absolute reference" ; rdfs:seeAlso ; rdfs:subClassOf . nxdetector:trigger_dead_time a rdfs:Class ; rdfs:label "NXdetector/trigger_dead_time" ; rdfs:comment """ Time during which no new trigger signal can be accepted. Typically this is the trigger_delay_time + exposure_time + readout_time. This is important to know for time resolved experiments. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtas/entry/INSTRUMENT/SOURCE" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXspe/ENTRY/data/data" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXgeometry/ORIENTATION" ; rdfs:comment "orientation of component" ; rdfs:seeAlso ; rdfs:subClassOf , . nxdetector:dead_time a rdfs:Class ; rdfs:label "NXdetector/dead_time" ; rdfs:comment "Detector dead time" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtomophase/entry/instrument/SOURCE/type" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXreflections/bounding_box" ; rdfs:comment """ The bounding box around the recorded recorded reflection. Should be an integer array of length 6, where the 6 values are pixel positions or frame numbers, as follows: ===== =========================== index meaning ===== =========================== 0 The lower pixel x position 1 The upper pixel x position 2 The lower pixel y position 3 The upper pixel y position 4 The lower frame number 5 The upper frame number ===== =========================== """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdetector/calibration_method" ; rdfs:comment """ summary of conversion of array data to pixels (e.g. polynomial approximations) and location of details of the calibrations """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXpinhole" ; rdfs:comment """ \t\tA simple pinhole. \t\t \t\tFor more complex geometries, :ref:`NXaperture` should be used. \t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/DATA/Qdev" ; rdfs:comment """ .. index:: NXcanSAS (applications); Qdev Estimated :math:`Q` **resolution** (usually standard deviation). Must have the same units as :math:`Q`. When present, the name of this field is also recorded in the *resolutions* attribute of *Q*, as in:: Q/@resolutions=\"Qdev\" or:: Q/@resolutions=\"dQw\", \"dQl\" """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXinstrument/FLIPPER" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmonitor/depends_on" ; rdfs:comment """ NeXus positions components by applying a set of translations and rotations to apply to the component starting from 0, 0, 0. The order of these operations is critical and forms what NeXus calls a dependency chain. The depends_on field defines the path to the top most operation of the dependency chain or the string \".\" if located in the origin. Usually these operations are stored in a NXtransformations group. But NeXus allows them to be stored anywhere. The reference plane of the monitor contains the surface of the detector that faces the source and is the entry point of the beam. The reference point of the monitor in the x and y axis is its centre on this surface. The reference plane is orthogonal to the the z axis and the reference point on this z axis is where they intersect. .. image:: monitor/monitor.png :width: 40% """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdetector/start_time/start" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/PROCESS" ; rdfs:comment """ Description of a processing or analysis step. Add additional fields as needed to describe value(s) of any variable, parameter, or term related to the *SASprocess* step. Be sure to include *units* attributes for all numerical fields. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXcollimator/frequency_log" ; rdfs:comment "Log of frequency" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXmonitor/efficiency" ; rdfs:comment "Monitor efficiency" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXrefscan/entry/control" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXinsertion_device/TRANSFORMATIONS" ; rdfs:comment """ This is the group recommended for holding the chain of translation and rotation operations necessary to position the component within the instrument. The dependency chain may however traverse similar groups in other component groups. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXfluo/entry/INSTRUMENT" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXcite/doi" ; rdfs:comment "DOI referencing the document or data." ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXgeometry/SHAPE" ; rdfs:comment "shape/size information of component" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/DATA/Q_indices" ; rdfs:comment """ Integer or integer array that describes which indices (of the :math:`I` data object) are used to reference the ``Q`` data object. The items in this array use zero-based indexing. Such as:: @Q_indices=1,3,4 which indicates that ``Q`` requires three indices from the :math:`I` data object: one for time and two for Q position. Thus, in this example, the ``Q`` data is time-dependent: :math:`\\vec{Q}(t)`. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXmonochromator/distribution" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtomo/entry/title" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcapillary/depends_on" ; rdfs:comment """ NeXus positions components by applying a set of translations and rotations to apply to the component starting from 0, 0, 0. The order of these operations is critical and forms what NeXus calls a dependency chain. The depends_on field defines the path to the top most operation of the dependency chain or the string \".\" if located in the origin. Usually these operations are stored in a NXtransformations group. But NeXus allows them to be stored anywhere. .. todo:: Add a definition for the reference point of a capillary lens. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/observed_x_errors/description" ; rdfs:comment "Describes the dataset " ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXoff_geometry/detector_faces" ; rdfs:comment """ List of pairs of index in the \"faces\" dataset and detector id. Face IDs in the first column, and corresponding detector IDs in the second column. This dataset should only be used only if the ``NXoff_geometry`` group is describing a detector. Note, the face indices must be in ascending order but need not be consecutive as not every face in faces need be a detecting surface or boundary of detecting volume. Can use multiple entries with the same detector id to define detector volumes. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXattenuator/status/time" ; rdfs:comment "time stamp for this observation" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXentry/USER" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtomoproc/entry/title" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXiqproc/ENTRY/reduction/input" ; rdfs:comment "Input parameters for the reduction program used" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXreftof/entry/end_time" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . nxdetector:bit_depth_readout a rdfs:Class ; rdfs:label "NXdetector/bit_depth_readout" ; rdfs:comment """ How many bits the electronics reads per pixel. With CCD's and single photon counting detectors, this must not align with traditional integer sizes. This can be 4, 8, 12, 14, 16, ... """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXbeam_stop/status" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXindirecttof/entry/INSTRUMENT/analyser" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtofnpd/entry/definition" ; rdfs:comment " Official NeXus NXDL schema to which this file conforms " ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXlauetof/entry/definition" ; rdfs:comment " Official NeXus NXDL schema to which this file conforms " ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/INSTRUMENT/DETECTOR/x_position" ; rdfs:comment "Location of the detector in :math:`x`" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXvelocity_selector/twist" ; rdfs:comment "twist angle along axis" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsubentry/COLLECTION" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdetector_channel/flatfield_applied" ; rdfs:comment """ True when the flat field correction has been applied in the electronics, false otherwise. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsource/current" ; rdfs:comment "Accelerator, X-ray tube, or storage ring current" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxraylens/symmetric" ; rdfs:comment """ Is the device symmetric? """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsastof/ENTRY/definition" ; rdfs:comment " Official NeXus NXDL schema to which this file conforms " ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXsas/ENTRY/INSTRUMENT/MONOCHROMATOR/wavelength_spread" ; rdfs:comment """ \t delta_lambda/lambda (:math:`\\Delta\\lambda/\\lambda`): \t Important for resolution calculations. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NX_COUNT" ; rdfs:comment """ \t\t\t\tunits of quantity of item(s) such as number of photons, \t\t\t\tneutrons, pulses, or other counting events \t\t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdisk_chopper/default" ; rdfs:comment """ .. index:: plotting Declares which child group contains a path leading to a :ref:`NXdata` group. It is recommended (as of NIAC2014) to use this attribute to help define the path to the default dataset to be plotted. See https://www.nexusformat.org/2014_How_to_find_default_data.html for a summary of the discussion. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcrystal/segment_rows" ; rdfs:comment "number of segment rows in vertical direction" ; rdfs:seeAlso ; rdfs:subClassOf . nxdetector:polar_angle a rdfs:Class ; rdfs:label "NXdetector/polar_angle" ; rdfs:comment """ This is the polar angle of the detector towards the previous component in the instrument; most often the sample. The usage depends on the nature of the detector. Most often it is the polar_angle of the detector assembly. But there are irregular detectors. In this case, the polar_angle must be specified for each detector pixel. Note, it is recommended to use NXtransformations instead. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtomo/entry/instrument/detector/distance" ; rdfs:comment "Distance between detector and sample" ; rdfs:seeAlso ; rdfs:subClassOf nxdetector:distance , . a rdfs:Class ; rdfs:label "NXtofnpd/entry/SAMPLE/name" ; rdfs:comment "Descriptive name of sample" ; rdfs:seeAlso ; rdfs:subClassOf , . nxdetector:slot a rdfs:Class ; rdfs:label "NXdetector/slot" ; rdfs:comment "Slot number of detector" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXroot/file_update_time" ; rdfs:comment "Date and time of last file change at close" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXevent_data/event_time_offset" ; rdfs:comment """ \t\t\tA list of timestamps for each event as it comes in. \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/DETECTOR/CHANNELNAME_channel" ; rdfs:comment """ Group containing the description and metadata for a single channel from a multi-channel detector. Given an :ref:`NXdata` group linked as part of an NXdetector group that has an axis with named channels (see the example in :ref:`NXdata `), the NXdetector will have a series of NXdetector_channel groups, one for each channel, named CHANNELNAME_channel. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXmonopd/entry/definition" ; rdfs:comment " Official NeXus NXDL schema to which this file conforms " ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXrefscan/entry/start_time" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtofnpd/entry/INSTRUMENT/detector" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxrot/entry/instrument/attenuator" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcollimator/depends_on" ; rdfs:comment """ NeXus positions components by applying a set of translations and rotations to apply to the component starting from 0, 0, 0. The order of these operations is critical and forms what NeXus calls a dependency chain. The depends_on field defines the path to the top most operation of the dependency chain or the string \".\" if located in the origin. Usually these operations are stored in a NXtransformations group. But NeXus allows them to be stored anywhere. Assuming a collimator with a \"flat\" entry surface, the reference plane is the plane which contains this surface. The reference point of the collimator in the x and y axis is the centre of the collimator entry surface on that plane. The reference plane is orthogonal to the z axis and the location of this plane is the reference point on the z axis. The collimator faces negative z values. .. image:: collimator/collimator.png :width: 40% """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdisk_chopper/slit_height" ; rdfs:comment "Total slit height" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/background_mean/description" ; rdfs:comment "Describes the dataset " ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/observed_frame_errors/description" ; rdfs:comment "Describes the dataset " ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsubentry/MONITOR" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsource/geometry" ; rdfs:comment """ \t\t\t\"Engineering\" location of source. \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXtofnpd/entry/INSTRUMENT/detector/detector_number" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcrystal/unit_cell_c" ; rdfs:comment "Unit cell lattice parameter: length of side c" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdetector/z_pixel_offset/axis" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXspe/ENTRY/data/azimuthal_width" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXfluo/entry/INSTRUMENT/fluorescence/data" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcapillary/accepting_aperture" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . nxdetector:acquisition_mode a rdfs:Class ; rdfs:label "NXdetector/acquisition_mode" ; rdfs:comment "The acquisition mode of the detector." ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxkappa/entry/instrument/detector/polar_angle" ; rdfs:comment "The polar_angle (two theta) at each scan point" ; rdfs:seeAlso ; rdfs:subClassOf nxdetector:polar_angle , . a rdfs:Class ; rdfs:label "NXtomo/entry/control" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/SAMPLE/transmission" ; rdfs:comment """ Transmission (:math:`I/I_0`) of this sample. There is no *units* attribute as this number is dimensionless. Note: the ability to store a transmission *spectrum*, instead of a single value, is provided elsewhere in the structure, in the *SAStransmission_spectrum* element. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxnb/entry/instrument/detector" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsastof/ENTRY/title" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmirror" ; rdfs:comment "A beamline mirror or supermirror." ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsample/type" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsqom/ENTRY/entry" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdisk_chopper/pair_separation" ; rdfs:comment "Disk spacing in direction of beam" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsas/ENTRY/INSTRUMENT/MONOCHROMATOR" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NX_ANY" ; rdfs:comment """ \t\t\t\tunits for things like logs that aren't picky on units \t\t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/polar_angle" ; rdfs:comment """ Polar angle of reflection centroid, following the NeXus simple (spherical polar) coordinate system """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXevent_data/event_id" ; rdfs:comment """ \t\t\tThere will be extra information in the NXdetector to convert \t\t\tevent_id to detector_number. \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreftof/entry/instrument/detector/data" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsubentry/revision/comment" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXpositioner/velocity" ; rdfs:comment "velocity of the positioner (distance moved per unit time)" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmoderator/TRANSFORMATIONS" ; rdfs:comment """ This is the group recommended for holding the chain of translation and rotation operations necessary to position the component within the instrument. The dependency chain may however traverse similar groups in other component groups. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/DETECTOR/flatfield_applied" ; rdfs:comment """ True when the flat field correction has been applied in the electronics, false otherwise. """ ; rdfs:seeAlso ; rdfs:subClassOf nxdetector:flatfield_applied , . a rdfs:Class ; rdfs:label "NXtomo/entry/sample/x_translation" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmirror/bend_angle_y" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmonochromator/wavelength_error" ; rdfs:comment "wavelength standard deviation" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/INSTRUMENT/APERTURE" ; rdfs:comment """ :ref:`NXaperture` is generic and limits the variation in data files. Possible NeXus base class alternatives are: :ref:`NXpinhole` or :ref:`NXslit`. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXbending_magnet/divergence_x_minus" ; rdfs:comment """ Accepted photon beam divergence in X- (horizontal inboard) direction. Note that divergence_x_plus+divergence_x_minus is the total horizontal beam divergence. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXarchive/entry/instrument/SOURCE/probe" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXsas/ENTRY/INSTRUMENT/MONOCHROMATOR/wavelength" ; rdfs:comment "The wavelength (:math:`\\lambda`) of the radiation." ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXmoderator/GEOMETRY" ; rdfs:comment "\"Engineering\" position of moderator" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/canSAS_class" ; rdfs:comment """ Official canSAS group: **SASentry** """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXfermi_chopper/absorbing_material" ; rdfs:comment "absorbing material" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxbase/entry/sample" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . nxdetector:time_of_flight a rdfs:Class ; rdfs:label "NXdetector/time_of_flight" ; rdfs:comment "Total time of flight" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsubentry/PROCESS" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/DETECTOR/DETECTOR_MODULE/data_origin" ; rdfs:comment """ A dimension-2 or dimension-3 field which gives the indices of the origin of the hyperslab of data for this module in the main area detector image in the parent NXdetector module. The data_origin is 0-based. The frame number dimension (nP) is omitted. Thus the data_origin field for a dimension-2 dataset with indices (nP, i, j) will be an array with indices (i, j), and for a dimension-3 dataset with indices (nP, i, j, k) will be an array with indices (i, j, k). The :ref:`order ` of indices (i, j or i, j, k) is slow to fast. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/SAMPLE/roll" ; rdfs:comment "Rotation of the sample about the :math:`z` axis (roll)" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcrystal" ; rdfs:comment """ A crystal monochromator or analyzer. Permits double bent monochromator comprised of multiple segments with anisotropic Gaussian mosaic. If curvatures are set to zero or are absent, array is considered to be flat. Scattering vector is perpendicular to surface. Crystal is oriented parallel to beam incident on crystal before rotation, and lies in vertical plane. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsample_component/description" ; rdfs:comment """ \t\t\tDescription of the sample component \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXentry/SAMPLE" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdetector_module/data_size" ; rdfs:comment """ \t\t\tTwo or three values for the size of the module in pixels in \t\t\teach direction. Dimensionality and order of indices is the \t\t\tsame as for data_origin. \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXarpes/ENTRY/INSTRUMENT/analyser/region_origin" ; rdfs:comment "origin of rectangular region selected for readout" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmirror/odd_layer_material" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXinsertion_device/phase" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXroot/HDF5_Version" ; rdfs:comment """ Version of HDF5 library used in writing the file. Note this attribute is spelled with uppercase \"V\", different than other version attributes. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdata" ; rdfs:comment """ \t\tThe :ref:`NXdata` class is designed to encapsulate all the information required for a set of data to be plotted. \t\tNXdata groups contain plottable data (sometimes referred to as *signals* or *dependent variables*) and their \t\tassociated axis coordinates (sometimes referred to as *axes* or *independent variables*). \t\tThe actual names of the :ref:`DATA ` and :ref:`AXISNAME ` fields \t\tcan be chosen :ref:`freely `, as indicated by the upper case (this is a common convention in all NeXus classes). \t\t \t\t.. note:: ``NXdata`` provides data and coordinates to be plotted but \t\t\tdoes not describe how the data is to be plotted or even the dimensionality of the plot. \t\t\thttps://www.nexusformat.org/NIAC2018Minutes.html#nxdata-plottype--attribute \t\t**Signals:** \t\t.. index:: plotting \t\t \t\tThe :ref:`DATA ` fields contain the signal values to be plotted. The name of the field \t\tto be used as the *default plot signal* is provided by the :ref:`signal ` attribute. \t\tThe names of the fields to be used as *secondary plot signals* are provided by the \t\t:ref:`auxiliary_signals` attribute. \t\tAn example with three signals, one of which being the default \t\t.. code-block:: \t\t\tdata:NXdata \t\t\t @signal = \"data1\" \t\t\t @auxiliary_signals = [\"data2\", \"data3\"] \t\t\t data1: float[10,20,30] --> the default signal \t\t\t data2: float[10,20,30] \t\t\t data3: float[10,20,30] \t\t**Axes:** \t\t.. index:: axes (attribute) \t\t.. index:: coordinates \t\tThe :ref:`AXISNAME ` fields contain the axis coordinates associated with the data values. \t\tThe names of all :ref:`AXISNAME ` fields are listed in the \t\t:ref:`axes ` attribute. \t\t`Rank` \t\t:ref:`AXISNAME ` fields are typically one-dimensional arrays, which annotate one of the dimensions. \t\tAn example of this would be \t\t.. code-block:: \t\t\tdata:NXdata \t\t\t @signal = \"data\" \t\t\t @axes = [\"x\", \"y\"] --> the order matters \t\t\t data: float[10,20] \t\t\t x: float[10] --> coordinates along the first dimension \t\t\t y: float[20] --> coordinates along the second dimension \t\tIn this example each data point ``data[i,j]`` has axis coordinates ``[x[i], y[j]]``. \t\tHowever, the fields can also have a rank greater than 1, in which case the rank of each \t\t:ref:`AXISNAME ` must be equal to the number of data dimensions it spans. \t\tAn example of this would be \t\t.. code-block:: \t\t\tdata:NXdata \t\t\t @signal = \"data\" \t\t\t @axes = [\"x\", \"y\"] --> the order does NOT matter \t\t\t @x_indices = [0, 1] \t\t\t @y_indices = [0, 1] \t\t\t data: float[10,20] \t\t\t x: float[10,20] --> coordinates along both dimensions \t\t\t y: float[10,20] --> coordinates along both dimensions \t\tIn this example each data point ``data[i,j]`` has axis coordinates ``[x[i,j], y[i,j]]``. \t\t`Dimensions` \t\tThe data dimensions annotated by an :ref:`AXISNAME ` field are defined by the \t\t:ref:`AXISNAME_indices ` attribute. When this attribute is missing, \t\tthe position(s) of the :ref:`AXISNAME ` string in the \t\t:ref:`axes ` attribute are used. \t\tWhen all :ref:`AXISNAME ` fields are one-dimensional, and none of the data dimensions \t\thave more than one axis, the :ref:`AXISNAME_indices ` attributes \t\tare often omitted. If one of the data dimensions has no :ref:`AXISNAME ` field, \t\tthe string “.” can be used in the corresponding index of the axes list. \t\tAn example of this would be \t\t.. code-block:: \t\t\tdata:NXdata \t\t\t @signal = \"data\" \t\t\t @axes = [\"x\", \".\", \"z\"] --> the order matters \t\t\t data: float[10,20,30] \t\t\t x: float[10] --> coordinates along the first dimension \t\t\t z: float[30] --> coordinates along the third dimension \t\tWhen using :ref:`AXISNAME_indices ` this becomes \t\t.. code-block:: \t\t\tdata:NXdata \t\t\t @signal = \"data\" \t\t\t @axes = [\"x\", \"z\"] --> the order does NOT matter \t\t\t data: float[10,20,30] \t\t\t @x_indices = 0 \t\t\t @z_indices = 2 \t\t\t x: float[10] --> coordinates along the first dimension \t\t\t z: float[30] --> coordinates along the third dimension \t\tWhen providing :ref:`AXISNAME_indices ` attributes it is recommended \t\tto do it for all axes. \t\t`Non-trivial axes` \t\tWhat follows are two examples where :ref:`AXISNAME_indices ` attributes \t\tcannot be omitted. \t\tThe first is an example where data dimensions have alternative axis coordinates. The NXdata group represents \t\ta stack of images collected at different energies. The ``wavelength`` is an alternative axis of ``energy`` \t\tfor the last dimension (or vice versa). \t\t.. code-block:: \t\t\tdata:NXdata \t\t\t @signal = \"data\" \t\t\t @axes = [\"x\", \"y\", \"energy\", \"wavelength\"] --> the order does NOT matter \t\t\t @x_indices = 0 \t\t\t @y_indices = 1 \t\t\t @energy_indices = 2 \t\t\t @wavelength_indices = 2 \t\t\t data: float[10,20,30] \t\t\t x: float[10] --> coordinates along the first dimension \t\t\t y: float[20] --> coordinates along the second dimension \t\t\t energy: float[30] --> coordinates along the third dimension \t\t\t wavelength: float[30] --> coordinates along the third dimension \t\tThe second is an example with coordinates that span more than one dimension. The NXdata group represents data \t\tfrom 2D mesh scans performed at multiple energies. Each data point ``data[i,j,k]`` has axis coordinates \t\t``[x[i,j,k], y[i,j,k], energy[k]]``. \t\t.. code-block:: \t\t\tdata:NXdata \t\t\t @signal = \"data\" \t\t\t @axes = [\"x\", \"y\", \"energy\"] --> the order does NOT matter \t\t\t @x_indices = [0, 1, 2] \t\t\t @y_indices = [0, 1, 2] \t\t\t @energy_indices = 2 \t\t\t data: float[10,20,30] \t\t\t x: float[10,20,30] --> coordinates along all dimensions \t\t\t y: float[10,20,30] --> coordinates along all dimensions \t\t\t energy: float[30] --> coordinates along the third dimension \t\t**Uncertainties:** \t\tStandard deviations on data values as well as coordinates can be provided by \t\t:ref:`FIELDNAME_errors ` fields where ``FIELDNAME`` is the name of a \t\t:ref:`DATA ` field or an :ref:`AXISNAME ` field. \t\tAn example of uncertainties on the signal, auxiliary signals and axis coordinates \t\t.. code-block:: \t\t\tdata:NXdata \t\t\t @signal = \"data1\" \t\t\t @auxiliary_signals = [\"data2\", \"data3\"] \t\t\t @axes = [\"x\", \"z\"] \t\t\t @x_indices = 0 \t\t\t @z_indices = 2 \t\t\t data1: float[10,20,30] \t\t\t data2: float[10,20,30] \t\t\t data3: float[10,20,30] \t\t\t x: float[10] \t\t\t z: float[30] \t\t\t data1_errors: float[10,20,30] \t\t\t data2_errors: float[10,20,30] \t\t\t data3_errors: float[10,20,30] \t\t\t x_errors: float[10] \t\t\t z_errors: float[30] \t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcollimator/soller_angle" ; rdfs:comment "Angular divergence of Soller collimator" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXfilter/m_value" ; rdfs:comment "m value of supermirror filter" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NX_CHAR" ; rdfs:comment """ \t\t\t\tThe preferred string representation is :index:`UTF-8`. \t\t\t\tBoth fixed-length strings and variable-length strings are valid. \t\t\t\tString arrays cannot be used where only a string is expected \t\t\t\t(title, start_time, end_time, ``NX_class`` attribute,...). \t\t\t\tFields or attributes requiring the use of string arrays will be \t\t\t\tclearly marked as such (like the ``NXdata`` attribute ``auxiliary_signals``). \t\t\t\tThis is the default field type. \t\t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/TRANSMISSION_SPECTRUM/timestamp" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdetector/COLLECTION" ; rdfs:comment """ Use this group to provide other data related to this NXdetector group. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXsubentry/SAMPLE" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsource/OFF_GEOMETRY" ; rdfs:comment """ This group describes the shape of the beam line component """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXinsertion_device/GEOMETRY" ; rdfs:comment "\"Engineering\" position of insertion device" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXcylindrical_geometry" ; rdfs:comment """ Geometry description for cylindrical shapes. This class can be used in place of ``NXoff_geometry`` when an exact representation for cylinders is preferred. For example, for Helium-tube, neutron detectors. It can be used to describe the shape of any beamline component, including detectors. In the case of detectors it can be used to define the shape of a single pixel, or, if the pixel shapes are non-uniform, to describe the shape of the whole detector. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsubentry" ; rdfs:comment """ \t\tGroup of multiple application definitions for \"multi-modal\" (e.g. SAXS/WAXS) measurements. \t\t \t\t``NXsubentry`` is a base class virtually identical to :ref:`NXentry` \t\tand is used as the (overlay) location for application definitions. \t\tUse a separate ``NXsubentry`` for each application definition. \t\t \t\tTo use ``NXsubentry`` with a hypothetical application definition \t\tcalled ``NXmyappdef``: \t\t* Create a group with attribute ``NX_class=\"NXsubentry\"`` \t\t* Within that group, create a field called ``definition=\"NXmyappdef\"``. \t\t* There are two optional attributes of definition: ``version`` and ``URL`` \t\tThe intended use is to define application definitions for a \t\tmulti-modal (a.k.a. multi-technique) :ref:`NXentry`. \t\tPreviously, an application definition \t\treplaced :ref:`NXentry` with its own definition. \t\tWith the increasing popularity of instruments combining \t\tmultiple techniques for data collection (such as SAXS/WAXS instruments), \t\tit was recognized the application definitions must be entered in the NeXus \t\tdata file tree as children of :ref:`NXentry`. \t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsource/bunch_distance" ; rdfs:comment "For storage rings, time between bunches" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtomoproc/entry/data/data/transform" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXindirecttof/entry/INSTRUMENT/analyser/polar_angle" ; rdfs:comment "polar angle towards sample" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsample_component/density" ; rdfs:comment "Density of sample component" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXbeam/TRANSFORMATIONS/reference_plane/transformation_type" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXsensor/run_control" ; rdfs:comment """ \t\t\tIs data collection controlled or synchronised to this quantity: \t\t\t1=no, 0=to \"value\", 1=to \"value_deriv1\", etc. \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/BEAM" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXxas/ENTRY/definition" ; rdfs:comment " Official NeXus NXDL schema to which this file conforms " ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXfermi_chopper/width" ; rdfs:comment "input beam width" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsqom/ENTRY/reduction/output" ; rdfs:comment "Eventual output parameters from the data reduction program used" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXdetector_module" ; rdfs:comment """ \t\tGeometry and logical description of a detector module. When used, child group to NXdetector. \t\t \t\tMany detectors consist of multiple \t\tsmaller modules. Sometimes it is important to know the exact position of such \t\tmodules. \t\tThis is the purpose of this group. It is a child group to NXdetector. \t\tNote, the pixel size is given as values in the array fast_pixel_direction and slow_pixel_direction. \t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/DETECTOR/pixel_mask_applied" ; rdfs:comment """ True when the pixel mask correction has been applied in the electronics, false otherwise. """ ; rdfs:seeAlso ; rdfs:subClassOf nxdetector:pixel_mask_applied , . a rdfs:Class ; rdfs:label "NXinstrument/INSERTION_DEVICE" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtomoproc/entry/SAMPLE/name" ; rdfs:comment "Descriptive name of sample" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXinstrument/BENDING_MAGNET" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXlauetof/entry/sample/unit_cell" ; rdfs:comment """ The unit cell, a, b, c, alpha, beta, gamma. Again, not strictly necessary, but normally written. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXreflections/int_prf_errors/description" ; rdfs:comment "Describes the dataset " ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXfilter/status" ; rdfs:comment "position with respect to in or out of the beam (choice of only \"in\" or \"out\")" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcapillary/type" ; rdfs:comment "Type of the capillary" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtomoproc/entry/data/z" ; rdfs:comment """ This is an array holding the values to use for the z-axis of data. The units must be appropriate for the measurement. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXdetector_module/module_offset/depends_on" ; rdfs:comment """ \t\t\t\tPoints to the path of the next element in the geometry chain. \t\t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXflipper/thickness" ; rdfs:comment "thickness along path of neutron travel" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxrot/entry/instrument/detector/beam_center_y" ; rdfs:comment """ This is the y position where the direct beam would hit the detector. This is a length, not a pixel position, and can be outside of the actual detector. """ ; rdfs:seeAlso ; rdfs:subClassOf nxdetector:beam_center_y , . a rdfs:Class ; rdfs:label "NX_MOLECULAR_WEIGHT" ; rdfs:comment """ \t\t\t\tunits of molecular weight \t\t\t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsensor/value_deriv1" ; rdfs:comment """ \t\t\tNominal/average first derivative of value \t\t\te.g. strain rate \t\t\t- same dimensions as \"value\" (may be a vector) \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXpolarizer/composition" ; rdfs:comment "description of the composition of the polarizing material" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/INSTRUMENT/canSAS_class" ; rdfs:comment "Official canSAS group: :index:`NXcanSAS (applications); SASinstrument`" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXflipper/TRANSFORMATIONS" ; rdfs:comment """ This is the group recommended for holding the chain of translation and rotation operations necessary to position the component within the instrument. The dependency chain may however traverse similar groups in other component groups. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXsubentry/collection_description" ; rdfs:comment "Brief summary of the collection, including grouping criteria." ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/DATA/I/uncertainties" ; rdfs:comment """ (optional: for numerical arrays) Names the dataset (in this SASdata group) that provides the uncertainty of :math:`I` to be used for data analysis. The name of the dataset containing the :math:`I` uncertainty is flexible. The name must be unique in the *SASdata* group. .. comment see: https://github.com/canSAS-org/canSAS2012/issues/7 Generally, this is the estimate of the uncertainty of each :math:`I`. Typically the estimated standard deviation. *Idev* is the canonical name from the 1D standard. The NXcanSAS standard allows for the name to be described using this attribute. Such as:: @uncertainties=\"Idev\" """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxraylens/number_of_lenses" ; rdfs:comment "Number of lenses that make up the compound lens." ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXspe/ENTRY/NXSPE_info/fixed_energy" ; rdfs:comment "The fixed energy used for this file." ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/d/description" ; rdfs:comment "Describes the dataset " ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXarchive/entry/user" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxbase/entry/control/mode" ; rdfs:comment """ Count to a preset value based on either clock time (timer) or received monitor counts (monitor). """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXsample/component" ; rdfs:comment "Details of the component of the sample and/or can" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXarchive/entry/experiment_identifier" ; rdfs:comment "unique identifier for the experiment" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXdata/DATA/signal" ; rdfs:comment """ \t\t\t\t.. index:: plotting \t \t\t\t\tPlottable (independent) axis, indicate index number. \t\t\t\tOnly one field in a :ref:`NXdata` group may have the \t\t\t\t``signal=1`` attribute. \t\t\t\tDo not use the ``signal`` attribute with the ``axis`` attribute. \t\t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxas/ENTRY/INSTRUMENT/absorbed_beam" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmonochromator/OFF_GEOMETRY" ; rdfs:comment """ This group describes the shape of the beam line component """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXsample/density" ; rdfs:comment "Density of sample" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmonopd/entry/INSTRUMENT" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXattenuator/type" ; rdfs:comment "Type or composition of attenuator, e.g. polythene" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXinsertion_device/harmonic" ; rdfs:comment "harmonic number of peak" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXinsertion_device/k" ; rdfs:comment "beam displacement parameter" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXbeam_stop/description" ; rdfs:comment "description of beamstop" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsample_component/volume_fraction" ; rdfs:comment "Volume fraction of component" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmonochromator/TRANSFORMATIONS" ; rdfs:comment """ This is the group recommended for holding the chain of translation and rotation operations necessary to position the component within the instrument. The dependency chain may however traverse similar groups in other component groups. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXsubentry/collection_identifier" ; rdfs:comment "User or Data Acquisition defined group of NeXus files or :ref:`NXentry`" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxasproc/ENTRY/title" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmonopd/entry/INSTRUMENT/DETECTOR/polar_angle" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf nxdetector:polar_angle , . a rdfs:Class ; rdfs:label "NXmoderator/type" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/SAMPLE/name" ; rdfs:comment "**ID**: Text string that identifies this sample." ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXrefscan/entry/instrument/DETECTOR/data" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/INSTRUMENT/DETECTOR/SDD" ; rdfs:comment """ Distance between sample and detector. Note: In NXdetector, the ``distance`` field records the distance to the previous component ... most often the sample. This use is the same as ``SDD`` for most SAS instruments but not all. For example, Bonse-Hart cameras have one or more crystals between the sample and detector. We define here the field ``SDD`` to document without ambiguity the distance between sample and detector. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxkappa/entry/sample" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXshape/size" ; rdfs:comment """ \t\t\tphysical extent of the object along its local axes (after NXorientation) \t\t\twith the center of mass at the local origin (after NXtranslation). \t\t\tThe meaning and location of these axes will vary according to the value \t\t\tof the \"shape\" variable. \t\t\t``nshapepar`` defines how many parameters: \t\t\t- For \"nxcylinder\" type the parameters are (diameter,height) and a three value orientation vector of the cylinder. \t\t\t- For the \"nxbox\" type the parameters are (length,width,height). \t\t\t- For the \"nxsphere\" type the parameters are (diameter). \t\t\t- For nxcone cone half aperture \t\t\t- For nxelliptical, semi-major axis, semi-minor-axis, angle of major axis and pole \t\t\t- For nxtoroidal, major radius, minor radius \t\t\t- For nxparabolic, parabolic parameter a \t\t\t- For nxpolynomial, an array of polynom coefficients, the dimension of the array \t\t\t encodes the degree of the polynom \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXflipper/comp_current" ; rdfs:comment "Compensating field coil current in \"on\" state\"" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/DETECTOR/DETECTOR_MODULE/fast_pixel_direction/depends_on" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxas/ENTRY/MONITOR/preset" ; rdfs:comment "preset value for time or monitor" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtofnpd/entry/user/name" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcrystal/curvature_vertical" ; rdfs:comment "Vertical curvature of focusing crystal" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXlog/value" ; rdfs:comment """ \t Array of logged value, such as temperature. If this is \t a single value the dimensionality is \t nEntries. However, NXlog can also be used to store \t multi dimensional time stamped data such as images. In \t this example the dimensionality of values would be value[nEntries,xdim,ydim]. \t """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXlog/minimum_value" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxrot/entry/definition" ; rdfs:comment "Official NeXus NXDL schema to which this file conforms." ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NX_UINT" ; rdfs:comment "any representation of an unsigned integer number (includes zero)" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXgeometry/description" ; rdfs:comment """ Optional description/label. Probably only present if we are an additional reference point for components rather than the location of a real component. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdisk_chopper/TRANSFORMATIONS" ; rdfs:comment """ This is the group recommended for holding the chain of translation and rotation operations necessary to position the component within the instrument. The dependency chain may however traverse similar groups in other component groups. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXsubentry/definition_local" ; rdfs:comment """ \t\t\tLocal NXDL schema extended from the subentry \t\t\tspecified in the ``definition`` field. \t\t\tThis contains any locally-defined, \t\t\tadditional fields in the subentry. \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/observed_px_x_var/description" ; rdfs:comment "Describes the dataset " ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdetector/slot/local_name" ; rdfs:comment "Equivalent local term" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/time_zone" ; rdfs:comment """ ISO 8601 time_zone offset from UTC. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdetector/GEOMETRY" ; rdfs:comment "Position and orientation of detector" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXreftof/entry/instrument" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXroot/default" ; rdfs:comment """ .. index:: find the default plottable data .. index:: plotting .. index:: default attribute value Declares which :ref:`NXentry` group contains the data to be shown by default. It is used to resolve ambiguity when more than one :ref:`NXentry` group exists. The value :ref:`names ` the default :ref:`NXentry` group. The value must be the name of a child of the current group. The child must be a NeXus group or a link to a NeXus group. It is recommended (as of NIAC2014) to use this attribute to help define the path to the default dataset to be plotted. See https://www.nexusformat.org/2014_How_to_find_default_data.html for a summary of the discussion. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsubentry/PARAMETERS" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdisk_chopper" ; rdfs:comment """ \t\tA device blocking the beam in a temporal periodic pattern. \t\tA disk which blocks the beam but has one or more slits to periodically \t\tlet neutrons through as the disk rotates. Often used in pairs, one \t\tNXdisk_chopper should be defined for each disk. \t\tThe rotation of the disk is commonly monitored by recording a timestamp for \t\teach full rotation of disk, by having a sensor in the stationary disk housing \t\tsensing when it is aligned with a feature (such as a magnet) on the disk. \t\tWe refer to this below as the \"top-dead-center signal\". \t\tAngles and positive rotation speeds are measured in an anticlockwise \t\tdirection when facing away from the source. \t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmonochromator/geometry" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreflections/predicted_px_y" ; rdfs:comment """ The y pixel position at which the bragg peak of the reflection is predicted """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXbeam/TRANSFORMATIONS/DIRECTION/depends_on" ; rdfs:comment """ Points to the path to a field defining the location on which this depends or the string \".\" for origin. """ ; rdfs:seeAlso ; rdfs:subClassOf , . nxdetector:input a rdfs:Class ; rdfs:label "NXdetector/input" ; rdfs:comment "Input number of detector" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxasproc/ENTRY/XAS_data_reduction/version" ; rdfs:comment "Version of the program used" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXinsertion_device/energy" ; rdfs:comment "energy of peak intensity in output spectrum" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/end_time_estimated" ; rdfs:comment """ ISO 8601 time/date of the last data point collected in UTC, using the Z suffix to avoid confusion with local time. Note that the time zone of the beamline should be provided in NXentry/NXinstrument/time_zone. This field may be filled with a value estimated before an observed value is available. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtofnpd/entry/SAMPLE" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/SOURCE" ; rdfs:comment """ The neutron or x-ray storage ring/facility. Note, the NXsource base class has many more fields available, but at present we only require the name. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXinstrument/APERTURE" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . nxdetector:azimuthal_angle a rdfs:Class ; rdfs:label "NXdetector/azimuthal_angle" ; rdfs:comment """ This is the azimuthal angle angle of the detector towards the previous component in the instrument; most often the sample. The usage depends on the nature of the detector. Most often it is the azimuthal_angle of the detector assembly. But there are irregular detectors. In this case, the azimuthal_angle must be specified for each detector pixel. Note, it is recommended to use NXtransformations instead. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdata/AXISNAME" ; rdfs:comment """ \t\t\tCoordinate values along one or more :ref:`data ` dimensions. The rank must be equal \t\t\tto the number of dimensions it spans. \t\t\t \t\t\tAs the upper case ``AXISNAME`` indicates, the names of the ``AXISNAME`` fields can be chosen :ref:`freely `. \t\t\tThe :ref:`axes ` attribute can be used to find all datasets in the \t\t\t``NXdata`` that contain coordinate values. \t\t\tMost AXISNAME fields will be sequences of numbers but if an axis is better represented using names, such as channel names, \t\t\tan array of NX_CHAR can be provided. \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxasproc/ENTRY/XAS_data_reduction/program" ; rdfs:comment "Name of the program used for reconstruction" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXentry/DATA" ; rdfs:comment """ \t\t\tThe data group \t\t\t.. note:: Before the NIAC2016 meeting [#]_, at least one \t\t\t :ref:`NXdata` group was required in each :ref:`NXentry` group. \t\t\t At the NIAC2016 meeting, it was decided to make :ref:`NXdata` \t\t\t an optional group in :ref:`NXentry` groups for data files that \t\t\t do not use an application definition. \t\t\t It is recommended strongly that all NeXus data files provide \t\t\t a NXdata group. \t\t\t It is permissable to omit the NXdata group only when \t\t\t defining the default plot is not practical or possible \t\t\t from the available data. \t\t\t For example, neutron event data may not have anything that \t\t\t makes a useful plot without extensive processing. \t\t\t Certain application definitions override this decision and \t\t\t require an :ref:`NXdata` group \t\t\t in the :ref:`NXentry` group. The ``minOccurs=0`` attribute \t\t\t in the application definition will indicate the \t\t\t :ref:`NXdata` group \t\t\t is optional, otherwise, it is required. \t\t\t .. [#] NIAC2016: \t\t\t https://www.nexusformat.org/NIAC2016.html, \t\t\t https://github.com/nexusformat/NIAC/issues/16 \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NX_MASS_DENSITY" ; rdfs:comment """ \t\t\t\tunits of mass density \t\t\t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXarchive/entry/instrument" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXarchive/entry/sample/electric_field" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmirror/incident_angle" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXuser" ; rdfs:comment """ \t\tContact information for a user. \t\t \t\tThe format allows more \t\tthan one user with the same affiliation and contact information, \t\tbut a second :ref:`NXuser` group should be used if they have different \t\taffiliations, etc. \t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxraylens" ; rdfs:comment """ An X-ray lens, typically at a synchrotron X-ray beam line. Based on information provided by Gerd Wellenreuther (DESY). """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmonopd/entry/INSTRUMENT/DETECTOR" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXinstrument/XRAYLENS" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:comment "An unconstrained type or object" . a rdfs:Class ; rdfs:label "NXmx" ; rdfs:comment """ functional application definition for macromolecular crystallography """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdetector_group" ; rdfs:comment """ \t\tLogical grouping of detectors. When used, describes a group of detectors. \t\tEach detector is represented as an NXdetector \t\twith its own detector data array. Each detector data array \t\tmay be further decomposed into array sections by use of \t\tNXdetector_module groups. Detectors can be grouped logically \t\ttogether using NXdetector_group. Groups can be further grouped \t\thierarchically in a single NXdetector_group (for example, if \t\tthere are multiple detectors at an endstation or multiple \t\tendstations at a facility). Alternatively, multiple \t\tNXdetector_groups can be provided. \t\tThe groups are defined hierarchically, with names given \t\tin the group_names field, unique identifying indices given \t\tin the field group_index, and the level in the hierarchy \t\tgiven in the group_parent field. For example if an x-ray \t\tdetector group, DET, consists of four detectors in a \t\trectangular array:: \t\t\t\t\t\t \t\t\t\t DTL\tDTR \t\t\t\t DLL\tDLR \t\t\t\t\t\t \t\tWe could have:: \t\t\t\t\t \t\t\tgroup_names: [\"DET\", \"DTL\", \"DTR\", \"DLL\", \"DLR\"] \t\t \tgroup_index: [1, 2, 3, 4, 5] \t\t \tgroup_parent: [-1, 1, 1, 1, 1] \t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXbeam/default" ; rdfs:comment """ .. index:: plotting Declares which child group contains a path leading to a :ref:`NXdata` group. It is recommended (as of NIAC2014) to use this attribute to help define the path to the default dataset to be plotted. See https://www.nexusformat.org/2014_How_to_find_default_data.html for a summary of the discussion. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXfermi_chopper" ; rdfs:comment "A Fermi chopper, possibly with curved slits." ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXguide/TRANSFORMATIONS" ; rdfs:comment """ This is the group recommended for holding the chain of translation and rotation operations necessary to position the component within the instrument. The dependency chain may however traverse similar groups in other component groups. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/INSTRUMENT/DETECTOR/beam_center_y" ; rdfs:comment """ Position of the beam center on the detector. This is the y position where the direct beam would hit the detector plane. This is a length and can be outside of the actual detector. The length can be in physical units or pixels as documented by the units attribute. The value can be any real number (positive, zero, or negative). """ ; rdfs:seeAlso ; rdfs:subClassOf nxdetector:beam_center_y , . a rdfs:Class ; rdfs:label "NXtofnpd/entry/start_time" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsource/flux" ; rdfs:comment "Source intensity/area (example: s-1 cm-2)" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXenvironment/type" ; rdfs:comment "Type of apparatus. This could be the SE codes in scheduling database; e.g. OC/100" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/INSTRUMENT/DETECTOR/y_position" ; rdfs:comment "Location of the detector in :math:`y`" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtofnpd/entry/MONITOR/mode" ; rdfs:comment """ Count to a preset value based on either clock time (timer) or received monitor counts (monitor). """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NX_TEMPERATURE" ; rdfs:comment """ \t\t\t\tunits of temperature \t\t\t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtransformations/AXISNAME/offset" ; rdfs:comment """ \t\t\t\tA fixed offset applied before the transformation (three vector components). \t\t\t\tThis is not intended to be a substitute for a fixed ``translation`` axis but, for example, \t\t\t\tas the mechanical offset from mounting the axis to its dependency. \t\t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxas/ENTRY/SAMPLE/name" ; rdfs:comment "Descriptive name of sample" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/ATTENUATOR/attenuator_transmission" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsas/ENTRY/MONITOR/integral" ; rdfs:comment "Total integral monitor counts." ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtofsingle/entry/SAMPLE/nature" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXfilter/temperature_log" ; rdfs:comment "Linked temperature_log for the filter" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXtofsingle/entry/MONITOR/preset" ; rdfs:comment "preset value for time or monitor" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxrot/entry" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXtas/entry/SAMPLE/en" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxas/ENTRY/INSTRUMENT/SOURCE/type" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . nxdetector:distance a rdfs:Class ; rdfs:label "NXdetector/distance" ; rdfs:comment """ This is the distance to the previous component in the instrument; most often the sample. The usage depends on the nature of the detector: Most often it is the distance of the detector assembly. But there are irregular detectors. In this case the distance must be specified for each detector pixel. Note, it is recommended to use NXtransformations instead. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXarchive/entry/collection_identifier" ; rdfs:comment "ID of user or DAQ define group of data files " ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXdetector/time_of_flight/primary" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXrefscan/entry/definition" ; rdfs:comment " Official NeXus NXDL schema to which this file conforms " ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXrefscan/entry/instrument" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/PROCESS/date" ; rdfs:comment """ \t\t\tOptional date for this data processing or analysis step. [#iso8601]_ \t\t\t \t\t\t \t\t\t.. [#iso8601] ISO-8601 standard time representation. \t\t\t \t\t\t\tNeXus dates and times are reported in ISO-8601 \t\t\t\t(e.g., ``yyyy-mm-ddThh:mm:ss``) \t\t\t\tor modified ISO-8601 (e.g., ``yyyy-mm-dd hh:mm:ss``). \t\t\t\t \t\t\t\tSee: http://www.w3.org/TR/NOTE-datetime \t\t\t\tor http://en.wikipedia.org/wiki/ISO_8601 for more details. \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXdetector_module/slow_pixel_direction/vector" ; rdfs:comment """ \t\t\t\tThree values that define the axis for this transformation \t\t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsas/ENTRY/INSTRUMENT/COLLIMATOR/GEOMETRY/SHAPE/shape" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXinstrument/DETECTOR_GROUP" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . nxdetector:detection_gas_path a rdfs:Class ; rdfs:label "NXdetector/detection_gas_path" ; rdfs:comment "maximum drift space dimension" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsastof/ENTRY/instrument" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXenvironment/NOTE" ; rdfs:comment "Additional information, LabView logs, digital photographs, etc" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXrefscan/entry" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/INSTRUMENT/SOURCE" ; rdfs:comment """ Description of the radiation source. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXtomoproc/entry/INSTRUMENT/SOURCE/type" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXarchive/entry/sample/stress_field" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXarchive/entry/sample/name" ; rdfs:comment "Descriptive name of sample" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXevent_data/event_time_zero" ; rdfs:comment """ \t\t\tThe time that each pulse started with respect to the offset \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NX_EMITTANCE" ; rdfs:comment """ \t\t\t\tunits of emittance (``length * angle``) of a \t\t\t\tradiation source \t\t\t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtofnpd/entry" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXaperture/OFF_GEOMETRY" ; rdfs:comment """ Use this group to describe the shape of the aperture """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXgrating/period" ; rdfs:comment "List of polynomial coefficients describing the spatial separation of lines/grooves as a function of position along the grating, in increasing powers of position. Gratings which do not have variable line spacing will only have a single coefficient (constant)." ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXiqproc/ENTRY/reduction/version" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreftof/entry/control/mode" ; rdfs:comment """ Count to a preset value based on either clock time (timer) or received monitor counts (monitor). """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXuser/name" ; rdfs:comment "Name of user responsible for this entry" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXarchive/entry/instrument/SOURCE/type" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXdisk_chopper/distance" ; rdfs:comment """ \t\t\tEffective distance to the origin. \t\t\tNote, it is recommended to use NXtransformations instead. \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXbeam/final_wavelength_spread" ; rdfs:comment "Wavelength spread FWHM of beam leaving this component" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXprocess" ; rdfs:comment "Document an event of data processing, reconstruction, or analysis for this data." ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtomoproc/entry/data/data" ; rdfs:comment """ This is the reconstructed volume. This can be different things. Please indicate in the unit attribute what physical quantity this really is. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NX_CCOMPLEX" ; rdfs:comment """ \t\t\tCompound type cartesian representation of complex numbers (real and \t\t\timaginary parts) in NeXus. \t\t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsample/unit_cell_alphabetagamma" ; rdfs:comment "Crystallography unit cell parameters alpha, beta, and gamma" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxrot/entry/instrument/detector" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdetector_module/depends_on" ; rdfs:comment """ Points to the start of the dependency chain for this module. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmirror/coating_roughness" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXguide/reflectivity" ; rdfs:comment "Reflectivity as function of reflecting surface and wavelength" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXcylindrical_geometry/vertices" ; rdfs:comment """ List of x,y,z coordinates for vertices. The origin of the coordinates is the position of the parent component, for example the NXdetector which the geometry describes. If the shape describes a single pixel for a detector with uniform pixel shape then the origin is the position of each pixel as described by the ``x/y/z_pixel_offset`` datasets in ``NXdetector``. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXstxm/ENTRY/DATA/energy" ; rdfs:comment """ List of photon energies of the X-ray beam. If scanned through multiple values, then an 'axis' attribute will be required to link the field to the appropriate data array dimension.""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsas/ENTRY/SAMPLE" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXroot/NeXus_version" ; rdfs:comment """ Version of NeXus API used in writing the file. Only used when the NAPI has written the file. Note that this is different from the version of the base class or application definition version number. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXfluo/entry/INSTRUMENT/fluorescence/energy" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxbase/entry/instrument/detector/data" ; rdfs:comment """ The area detector data, the first dimension is always the number of scan points, the second and third are the number of pixels in x and y. The origin is always assumed to be in the center of the detector. maxOccurs is limited to the the number of detectors on your instrument. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXenvironment" ; rdfs:comment "Parameters for controlling external conditions" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXbeam_stop" ; rdfs:comment """ A device that blocks the beam completely, usually to protect a detector. Beamstops and their positions are important for SANS and SAXS experiments. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXiqproc/ENTRY/instrument/SOURCE" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtransformations/AXISNAME/transformation_type" ; rdfs:comment """ \t\t\t\tThe transformation_type may be ``translation``, in which case the \t\t\t\tvalues are linear displacements along the axis, ``rotation``, \t\t\t\tin which case the values are angular rotations around the axis. \t\t\t\tIf this attribute is omitted, this is an axis for which there \t\t\t\tis no motion to be specifies, such as the direction of gravity, \t\t\t\tor the direction to the source, or a basis vector of a \t\t\t\tcoordinate frame. In this case the value of the ``AXISNAME`` field \t\t\t\tis not used and can be set to the number ``NaN``. \t\t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXreftof/entry/control/time_of_flight" ; rdfs:comment "Time channels" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXsample_component" ; rdfs:comment """ \t\tOne group like this per component can be recorded For a sample consisting of multiple components. \t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXvelocity_selector/wavelength" ; rdfs:comment "wavelength" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtomoproc/entry/SAMPLE" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtofsingle/entry/INSTRUMENT/detector/azimuthal_angle" ; rdfs:comment "azimuthal angle for each detector element" ; rdfs:seeAlso ; rdfs:subClassOf nxdetector:azimuthal_angle , . a rdfs:Class ; rdfs:label "NXvelocity_selector/table" ; rdfs:comment "offset vertical angle" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsource/voltage" ; rdfs:comment "Accelerator voltage" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXarchive" ; rdfs:comment """ \tThis is a definition for data to be archived by ICAT (http://www.icatproject.org/). \t \t.. text from the icatproject.org site \t \t the database (with supporting software) that provides an \t interface to all ISIS experimental data and will provide \t a mechanism to link all aspects of ISIS research from \t proposal through to publication. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsubentry/experiment_documentation" ; rdfs:comment "Description of the full experiment (document in pdf, latex, ...)" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXxnb/entry/sample/rotation_angle" ; rdfs:comment """ This is an array holding the sample rotation angle at each scan point """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXtas/entry/title" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXarchive/entry/index" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtomophase/entry/instrument/sample/data" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtomophase" ; rdfs:comment """ This is the application definition for x-ray or neutron tomography raw data with phase contrast variation at each point. In tomography first some dark field images are measured, some bright field images and, of course the sample. In order to properly sort the order of the images taken, a sequence number is stored with each image. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdata/z" ; rdfs:comment """ \t\t\tThis is an array holding the values to use for the z-axis of \t\t\tdata. The units must be appropriate for the measurement. \t\t\tThis is a special case of a :ref:`AXISNAME field ` \t\t\tkept for backward compatiblity. \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXarchive/entry/experiment_description" ; rdfs:comment "Brief description of the experiment and its objectives" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/INSTRUMENT/SOURCE/wavelength_max" ; rdfs:comment """ Some facilities specify wavelength using a range. This is the highest wavelength in such a range. """ ; rdfs:seeAlso ; rdfs:subClassOf . nxdetector:x_pixel_offset a rdfs:Class ; rdfs:label "NXdetector/x_pixel_offset" ; rdfs:comment """ Offset from the detector center in x-direction. Can be multidimensional when needed. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXbeam/energy_transfer" ; rdfs:comment "Change in particle energy caused by the beamline component" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXfluo/entry/MONITOR" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXfilter/substrate_material" ; rdfs:comment "substrate material of supermirror filter" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsas/ENTRY/start_time" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmonitor/time_of_flight" ; rdfs:comment "Time-of-flight" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXfresnel_zone_plate/mask_material" ; rdfs:comment "If no mask is present, set mask_thickness to 0 and omit the mask_material field" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/INSTRUMENT/COLLIMATOR/distance" ; rdfs:comment "Distance from this collimation element to the sample" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxas/ENTRY/INSTRUMENT/incoming_beam/data" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXfilter/unit_cell_c" ; rdfs:comment "Unit cell lattice parameter: length of side c" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcrystal/cylindrical_orientation_angle" ; rdfs:comment "If cylindrical: cylinder orientation angle" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdetector/efficiency/axes" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/DETECTOR_GROUP/group_index" ; rdfs:comment """ An array of unique identifiers for detectors or groupings of detectors. Each ID is a unique ID for the corresponding detector or group named in the field group_names. The IDs are positive integers starting with 1. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXsensor/TRANSFORMATIONS" ; rdfs:comment """ This is the group recommended for holding the chain of translation and rotation operations necessary to position the component within the instrument. The dependency chain may however traverse similar groups in other component groups. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXcapillary" ; rdfs:comment """ A capillary lens to focus the X-ray beam. Based on information provided by Gerd Wellenreuther (DESY). """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXentry/entry_identifier_uuid" ; rdfs:comment "UUID identifier for the measurement." ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXuser/role" ; rdfs:comment """ \t\t\tRole of user responsible for this entry. \t\t\tSuggested roles are \"local_contact\", \t\t\t\"principal_investigator\", and \"proposer\" \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsastof/ENTRY/start_time" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtomophase/entry/instrument/bright_field/sequence_number" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXattenuator/default" ; rdfs:comment """ .. index:: plotting Declares which child group contains a path leading to a :ref:`NXdata` group. It is recommended (as of NIAC2014) to use this attribute to help define the path to the default dataset to be plotted. See https://www.nexusformat.org/2014_How_to_find_default_data.html for a summary of the discussion. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NX_TIME_OF_FLIGHT" ; rdfs:comment """ \t\t\t\tunits of (neutron) time of flight \t\t\t\t(alias to `NX_TIME`) \t\t\t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXtas/entry/SAMPLE/sgl" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcollimator/OFF_GEOMETRY" ; rdfs:comment """ This group describes the shape of the beam line component """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXxasproc" ; rdfs:comment """ Processed data from XAS. This is energy versus I(incoming)/I(absorbed). """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXmx/ENTRY/INSTRUMENT/DETECTOR/detector_readout_time" ; rdfs:comment """ Time it takes to read the detector (typically milliseconds). This is important to know for time resolved experiments. """ ; rdfs:seeAlso ; rdfs:subClassOf nxdetector:detector_readout_time , . a rdfs:Class ; rdfs:label "NXxbase/entry/instrument/detector/x_pixel_size" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXsqom/ENTRY/title" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXscan/ENTRY/INSTRUMENT/DETECTOR" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxasproc/ENTRY/XAS_data_reduction" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXtransformations/AXISNAME_increment_set" ; rdfs:comment """ \t\t\t``AXISNAME_increment_set`` is a placeholder for a name constructed from the actual \t\t\tname of an axis to which ``_increment_set`` has been appended. \t\t\tThe value of this optional field is the intended average range through which \t\t\tthe corresponding axis moves during the exposure of a frame. Ideally, the \t\t\tvalue of this field added to each value of ``AXISNAME`` would agree with the \t\t\tcorresponding values of ``AXISNAME_end``, but there is a possibility of significant \t\t\tdifferences. Use of ``AXISNAME_end`` is recommended. \t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXxas" ; rdfs:comment """ This is an application definition for raw data from an X-ray absorption spectroscopy experiment. This is essentially a scan on energy versus incoming/ absorbed beam. """ ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXcanSAS/ENTRY/DATA/signal" ; rdfs:comment """ Name of the default data field. """ ; rdfs:seeAlso ; rdfs:subClassOf , . a rdfs:Class ; rdfs:label "NXreflections/d" ; rdfs:comment "The resolution of the reflection " ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXdetector_module/slow_pixel_direction/offset" ; rdfs:comment """ \t\t\t\tA fixed offset applied before the transformation (three vector components). \t\t\t""" ; rdfs:seeAlso ; rdfs:subClassOf . a rdfs:Class ; rdfs:label "NXarpes/ENTRY/DATA" ; rdfs:comment "" ; rdfs:seeAlso ; rdfs:subClassOf .